BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31007 (477 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23410.1 68415.m02795 dehydrodolichyl diphosphate synthase / ... 27 8.7 At1g18560.1 68414.m02315 hAT dimerisation domain-containing prot... 27 8.7 >At2g23410.1 68415.m02795 dehydrodolichyl diphosphate synthase / DEDOL-PP synthase (DPS) identical to dehydrodolichyl diphosphate synthase [Arabidopsis thaliana] GI:7960765 Length = 303 Score = 26.6 bits (56), Expect = 8.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 137 LYSNCSHLTT*NILYIGRYDDIRSIYFFKLVQFLYLQLFFCQIFW 271 L +NCS + +++ R + I F L Q Y +LFF +FW Sbjct: 235 LLTNCSDFPSPDLMI--RTSGEQRISNFFLWQLAYSELFFSPVFW 277 >At1g18560.1 68414.m02315 hAT dimerisation domain-containing protein / BED zinc finger domain-containing protein / transposase-related weak similarity to Tam3-transposase [Antirrhinum majus] GI:16064; contains Pfam profiles PF02892: BED zinc finger, PF05699: hAT family dimerisation domain Length = 676 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 69 SIDSTLELN---LNTKMMFSRIEENVYTVTVHILQLKIF 176 S+DS + N L +MM S +E+N T+ + L L F Sbjct: 369 SLDSVIRKNEDALENRMMLSSVEKNAVTIVHNYLDLDSF 407 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,391,588 Number of Sequences: 28952 Number of extensions: 143826 Number of successful extensions: 245 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -