BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31005 (857 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L22075-1|AAA74235.1| 377|Homo sapiens guanine nucleotide regula... 34 0.76 BC036756-1|AAH36756.1| 377|Homo sapiens guanine nucleotide bind... 34 0.76 AF493902-1|AAM12616.1| 377|Homo sapiens guanine nucleotide bind... 34 0.76 X14545-1|CAA32681.1| 157|Homo sapiens protein ( Human KT10E mRN... 33 1.0 BC027624-1|AAH27624.1| 519|Homo sapiens Bardet-Biedl syndrome 4... 31 7.1 BC008923-1|AAH08923.2| 461|Homo sapiens BBS4 protein protein. 31 7.1 AY457143-1|AAS13441.1| 527|Homo sapiens Bardet-Biedl syndrome 4... 31 7.1 AK075321-1|BAC11547.1| 519|Homo sapiens protein ( Homo sapiens ... 31 7.1 AF359281-1|AAK58868.1| 519|Homo sapiens Bardet-Biedl syndrome t... 31 7.1 >L22075-1|AAA74235.1| 377|Homo sapiens guanine nucleotide regulatory protein protein. Length = 377 Score = 33.9 bits (74), Expect = 0.76 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +2 Query: 485 HIPWAAHSDLRHRRSQILQYESRATNRSNDRSFPENY*MYIP*VRCLWNDTKTRRA 652 HIPW +S+ +H +++ +++RA + + Y+P +R LW D+ + A Sbjct: 107 HIPWGDNSNQQHG-DKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNA 161 >BC036756-1|AAH36756.1| 377|Homo sapiens guanine nucleotide binding protein (G protein), alpha 13 protein. Length = 377 Score = 33.9 bits (74), Expect = 0.76 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +2 Query: 485 HIPWAAHSDLRHRRSQILQYESRATNRSNDRSFPENY*MYIP*VRCLWNDTKTRRA 652 HIPW +S+ +H +++ +++RA + + Y+P +R LW D+ + A Sbjct: 107 HIPWGDNSNQQHG-DKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNA 161 >AF493902-1|AAM12616.1| 377|Homo sapiens guanine nucleotide binding protein alpha 13 protein. Length = 377 Score = 33.9 bits (74), Expect = 0.76 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +2 Query: 485 HIPWAAHSDLRHRRSQILQYESRATNRSNDRSFPENY*MYIP*VRCLWNDTKTRRA 652 HIPW +S+ +H +++ +++RA + + Y+P +R LW D+ + A Sbjct: 107 HIPWGDNSNQQHG-DKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNA 161 >X14545-1|CAA32681.1| 157|Homo sapiens protein ( Human KT10E mRNA for T-cell receptor delta-chain V(delta)1-N1- D(delta)1-N2-D(delta)2-N3-J(delta)3. ). Length = 157 Score = 33.5 bits (73), Expect = 1.0 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = -2 Query: 697 KMKIFSLRIIQSEDQSASCFCIVPEAPNLWNVHLVILGK 581 K ++ +Q ED SA FC + EAP+ W H +I GK Sbjct: 92 KSVALTISALQLED-SAKYFCALGEAPSAWGKHKLIFGK 129 >BC027624-1|AAH27624.1| 519|Homo sapiens Bardet-Biedl syndrome 4 protein. Length = 519 Score = 30.7 bits (66), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 637 CIVPEAPNLW-NVHLVILGKTSIIGSVRC 554 C VPE+P LW N+ + GK + ++ C Sbjct: 264 CAVPESPPLWNNIGMCFFGKKKYVAAISC 292 >BC008923-1|AAH08923.2| 461|Homo sapiens BBS4 protein protein. Length = 461 Score = 30.7 bits (66), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 637 CIVPEAPNLW-NVHLVILGKTSIIGSVRC 554 C VPE+P LW N+ + GK + ++ C Sbjct: 206 CAVPESPPLWNNIGMCFFGKKKYVAAISC 234 >AY457143-1|AAS13441.1| 527|Homo sapiens Bardet-Biedl syndrome 4 splice variant 1 protein. Length = 527 Score = 30.7 bits (66), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 637 CIVPEAPNLW-NVHLVILGKTSIIGSVRC 554 C VPE+P LW N+ + GK + ++ C Sbjct: 272 CAVPESPPLWNNIGMCFFGKKKYVAAISC 300 >AK075321-1|BAC11547.1| 519|Homo sapiens protein ( Homo sapiens cDNA FLJ90840 fis, clone Y79AA1002334, weakly similar to GLUCOSE REPRESSION MEDIATOR PROTEIN. ). Length = 519 Score = 30.7 bits (66), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 637 CIVPEAPNLW-NVHLVILGKTSIIGSVRC 554 C VPE+P LW N+ + GK + ++ C Sbjct: 264 CAVPESPPLWNNIGMCFFGKKKYVAAISC 292 >AF359281-1|AAK58868.1| 519|Homo sapiens Bardet-Biedl syndrome type 4 protein. Length = 519 Score = 30.7 bits (66), Expect = 7.1 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 637 CIVPEAPNLW-NVHLVILGKTSIIGSVRC 554 C VPE+P LW N+ + GK + ++ C Sbjct: 264 CAVPESPPLWNNIGMCFFGKKKYVAAISC 292 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,717,106 Number of Sequences: 237096 Number of extensions: 3166251 Number of successful extensions: 6748 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 6426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6747 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10928473528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -