BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS31001 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 23 9.0 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 9.0 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 514 KTDFNNKKLYIQPIP**KQKLLQ 446 + +FNNKK I +P KQK Q Sbjct: 49 EVEFNNKKAIIIYVPVPKQKAFQ 71 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.4 bits (48), Expect = 9.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 622 PKFGTLFKIKNSSTNLIVVKVSDLFFTYRSEQINN*KTDFNNKKL 488 PKF L K+ + TNLI+ ++ ++ N TD N+ L Sbjct: 257 PKFNRLMKLFDKLTNLILDQIERAMVSFE----KNPTTDSNHSAL 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 848,838 Number of Sequences: 2352 Number of extensions: 17274 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -