BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30998 (812 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F8.07c |||pyruvate decarboxylase |Schizosaccharomyces pombe... 31 0.15 SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosa... 28 1.8 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 25 9.7 SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo... 25 9.7 >SPAC1F8.07c |||pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 594 Score = 31.5 bits (68), Expect = 0.15 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 138 AGRLCIRKRARNRSRSAPLIISHAARSSILNEKKVYMQ 251 A +L A R+ AP++I HA R +IL K VY++ Sbjct: 134 AKKLTCAAVAIKRAEDAPVMIDHAIRQAILQHKPVYIE 171 >SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 300 Score = 27.9 bits (59), Expect = 1.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 234 KKVYMQKKIYYNYSKLCFQRDKNL 305 K VY+++KIY + +LC + D+ L Sbjct: 140 KHVYIRRKIYDSQHQLCIEEDRTL 163 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 25.4 bits (53), Expect = 9.7 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 280 SASNVIKIC-SPLRAGLCKRTLSLK 351 SA +++I SP AG+ KRTL LK Sbjct: 41 SAERIVEIGPSPTLAGMAKRTLKLK 65 >SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 262 TIITQNSASNVIKICSPLRAGLCKRTLSLKKWQHYRPCRACVTQTVNA 405 T+ +N + V KIC + +++ H+ CR CVT+ +NA Sbjct: 700 TVDIENQENIVCKICDEVAQD------AIESRCHHTFCRLCVTEYINA 741 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,934,619 Number of Sequences: 5004 Number of extensions: 58496 Number of successful extensions: 132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -