BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30998 (812 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1562 - 27738369-27738568,27738767-27738962,27739079-277392... 29 4.4 >07_03_1562 - 27738369-27738568,27738767-27738962,27739079-27739230, 27739775-27739832,27739923-27740038,27740117-27740237, 27740348-27740635,27740817-27740987,27741091-27741741, 27742515-27742676,27742764-27743904,27743992-27744152, 27744239-27744564,27745678-27745825 Length = 1296 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 268 ITQNSASNVIKICSPLRAGLCKRTLSLKKWQH 363 I NS N+I C+P A LC+ L+K H Sbjct: 892 IVSNSEKNLIGYCAPFLAKLCRNLALLQKLFH 923 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,266,848 Number of Sequences: 37544 Number of extensions: 343506 Number of successful extensions: 625 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2221181676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -