BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30996 (880 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 26 0.45 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 3.2 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 9.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 9.7 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 25.8 bits (54), Expect = 0.45 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 872 WLAFFQNSNPFVNQQPMAQKVSLKPIWRMEMRGL 771 W F +N NP +++ V+ KP+ R EM L Sbjct: 468 WTNFAKNGNPNPSEENPLINVTWKPVTRNEMNFL 501 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.4 bits (48), Expect = 2.4 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -2 Query: 777 GPESNSWVSQIAQRKEQLHLANSQL-GNLARK----NPLV*CPRNFRCKNSSQNH 628 G NSW S I K QL N+ K N V C R CK++ Q H Sbjct: 99 GSNDNSWESLIEVTKTSETSKLQQLVDNIEHKLSDPNQCVICHRVLSCKSALQMH 153 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 319 NTKPTLPLMCGNSFSRAGLLSSGL 248 N KP + +CG S++R L + L Sbjct: 246 NQKPNVCRICGKSYARPSTLKTHL 269 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 9.7 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -1 Query: 703 WKLGTEESSGLMSQKFQV 650 W + T++ +GL K+Q+ Sbjct: 361 WSIETDDFNGLSGTKYQI 378 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 86 NYFVKIIQLLDEYPKCF 136 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,653 Number of Sequences: 336 Number of extensions: 5641 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24306755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -