BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30995 (858 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyce... 27 3.4 SPAC8E11.09c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 4.5 SPAC30C2.04 |||cofactor for methionyl-and glutamyl-tRNA syntheta... 26 7.9 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 26 7.9 >SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 561 TNVKPTSTVANKPGAESMVTAEPYSLQWFVNHY 659 T++K A K GA+ ++T E +QW N Y Sbjct: 151 TDIKDVVEHAAKLGAQRLITLEELPVQWHNNPY 183 >SPAC8E11.09c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 416 PVKTLLPPKQTQTQCRQYRAAGHRTPHRPV 505 P + PK+ Q C Y +RTP PV Sbjct: 63 PPIAISDPKEAQNHCSSYYYIKYRTPDSPV 92 >SPAC30C2.04 |||cofactor for methionyl-and glutamyl-tRNA synthetases |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.8 bits (54), Expect = 7.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 589 QTNPARKVWSRLNPTASNGS*II 657 Q NP RK+W + P ++G +I Sbjct: 394 QLNPKRKIWEAIQPGFTSGEDLI 416 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.8 bits (54), Expect = 7.9 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 510 VQSNANAAIGDRFDSDDTNVKPTSTVANKPGAESMVTAEPYSLQWFVNHYSTT 668 V NA A R + + NVK +S +PG S+ P +Q ++ +TT Sbjct: 328 VSRNAQARTPSRLEQREVNVKNSSAKIVRPGT-SLGVRSPSRIQSTLSSRTTT 379 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,445,514 Number of Sequences: 5004 Number of extensions: 70182 Number of successful extensions: 188 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -