BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30994 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 25 0.75 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 5.3 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 5.3 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 5.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.3 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 25.0 bits (52), Expect = 0.75 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 284 HPWVRRHHGTHTASHVLAMTGVAFHHLVGGLEACV 180 H W+RR+ H TG H+VGGL + Sbjct: 181 HGWMRRNVLNKQHVHFHDYTGSVVIHVVGGLTGLI 215 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -2 Query: 288 FTSLGTTSPRY-TYSKPCTCHDGGRISPSGW 199 + SLG T++ PC CH G+ W Sbjct: 26 YVSLGALKMHIRTHTLPCKCHLCGKAFSRPW 56 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 346 NRFQGRYQLPA 378 NRF G Y++PA Sbjct: 435 NRFSGEYEIPA 445 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 307 QNQAYYPIRRLVSNRFQGRYQ 369 Q +A+Y +R +N FQ +YQ Sbjct: 17 QAKAHYSLRDFKANIFQVKYQ 37 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 275 VRRHHGTHTASHVLAMTGVAFHH 207 ++RHH H L T V HH Sbjct: 138 LQRHHHLQNHHHHLQSTAVQDHH 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,659 Number of Sequences: 438 Number of extensions: 4482 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -