BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30991 (703 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.6 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 9.7 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 9.7 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 9.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 110 NQIGAKSWEIISDEHGIDPTGAYHGDSDLQW 202 N+I + W + D G AYHGD QW Sbjct: 911 NRIRNQRWIVNRDTSGATGPFAYHGD---QW 938 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -2 Query: 324 GRSVRKVQSEQSPWCRAPSRRGWPGHVLAAGGFIVVY--IDALH 199 GRS V Q S G PG A GF+ Y D LH Sbjct: 764 GRSFELVNKTQFDIGAPASGGGTPGKYTAEAGFMSFYEICDFLH 807 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.0 bits (42), Expect = 9.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 661 LDGNWKNC 638 LDG+WK C Sbjct: 170 LDGDWKKC 177 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.0 bits (42), Expect = 9.7 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 549 LTELMNTFSSCYPSPKSCRTTISLNPYK 632 L N C S CRT SL P+K Sbjct: 298 LNSAANPIIYCLFSTHFCRTLGSLPPFK 325 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 428 RKEAESCECLQGF 466 RK AE C LQGF Sbjct: 240 RKTAEMCYKLQGF 252 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,557 Number of Sequences: 336 Number of extensions: 3466 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -