BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30988 (760 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58745-2|AAU05593.1| 569|Caenorhabditis elegans Hypothetical pr... 33 0.22 U58745-1|AAB00620.2| 574|Caenorhabditis elegans Hypothetical pr... 33 0.22 AC006633-5|AAO21429.1| 506|Caenorhabditis elegans Prion-like-(q... 29 2.7 AC006633-4|AAK68376.3| 1128|Caenorhabditis elegans Prion-like-(q... 29 2.7 Z93383-12|CAB07628.2| 283|Caenorhabditis elegans Hypothetical p... 29 4.7 AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical... 28 8.3 >U58745-2|AAU05593.1| 569|Caenorhabditis elegans Hypothetical protein C10G6.1b protein. Length = 569 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 257 VIKIIHDCRNDSVNLYNQFEITMKNVFDT 343 V+K+IHD R + L +++ + M+NVFDT Sbjct: 372 VVKVIHDARRVASLLAHKYAVHMRNVFDT 400 >U58745-1|AAB00620.2| 574|Caenorhabditis elegans Hypothetical protein C10G6.1a protein. Length = 574 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 257 VIKIIHDCRNDSVNLYNQFEITMKNVFDT 343 V+K+IHD R + L +++ + M+NVFDT Sbjct: 372 VVKVIHDARRVASLLAHKYAVHMRNVFDT 400 >AC006633-5|AAO21429.1| 506|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 34, isoform b protein. Length = 506 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +3 Query: 522 DMIIYAASDVLSLVNPAIYAYMSSNIMPENQQLFEELSMSKCLC 653 D +++ + + LV + S+ +PE + L+E++S +CLC Sbjct: 169 DALLFWINKICLLVRDDVEREDSNTNIPEMEDLYEDISDGQCLC 212 >AC006633-4|AAK68376.3| 1128|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 34, isoform a protein. Length = 1128 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +3 Query: 522 DMIIYAASDVLSLVNPAIYAYMSSNIMPENQQLFEELSMSKCLC 653 D +++ + + LV + S+ +PE + L+E++S +CLC Sbjct: 169 DALLFWINKICLLVRDDVEREDSNTNIPEMEDLYEDISDGQCLC 212 >Z93383-12|CAB07628.2| 283|Caenorhabditis elegans Hypothetical protein F54B8.7a protein. Length = 283 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = -1 Query: 358 SMGSLCIKHILHCDLKLIVQINRVISAVMNNFNDISLSNRSLIFPSFIIPGHVIISNVYT 179 S+ + I+ L L V IN+ V++ FN ++ N +LI IIP +I + YT Sbjct: 41 SLSIFYCRFIIDVFLTLSVSINKAYFLVISLFNQYAVKNLALI---LIIPSLMIATMRYT 97 Query: 178 SPFRV 164 F + Sbjct: 98 LGFLI 102 >AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical protein Y73B6BL.4 protein. Length = 546 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 39 RECATLIDSIMAPKRNAKNIVSFDCEGINLGLKGVLTLCQIATLNGE 179 R+C TLI +PK +++S D G G+ G+ L +I L+G+ Sbjct: 190 RQCLTLIGVHPSPKGKGVHVLSIDGGGTR-GMMGLEVLEKIEKLSGK 235 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,550,593 Number of Sequences: 27780 Number of extensions: 373130 Number of successful extensions: 863 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -