BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30987 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 24 4.0 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 9.3 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/71 (14%), Positives = 35/71 (49%) Frame = -1 Query: 582 KYNNFINQTVYRQYDFIVLYNSESVLPLHVFLYNILKTVTPLAAYKSSTLPSKLFPYQAN 403 ++ ++ ++ ++++ +V+ + ++++ + K + P YK+ T P +QA Sbjct: 67 QHRDWSDEEIFQRARRVVIASLQNIVAYEYLPAFLDKEIPPYDGYKADTHPGVSHMFQAA 126 Query: 402 IYTYHEQILFP 370 + + ++ P Sbjct: 127 AFRFGHSLIPP 137 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.0 bits (47), Expect = 9.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 423 LFPYQANIYTYHEQILFPLYICVY 352 ++P+ +Y YH QI + + VY Sbjct: 144 IYPHTGYLYYYHYQIFPKISLVVY 167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,263 Number of Sequences: 2352 Number of extensions: 11623 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -