BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30985 (715 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccha... 25 8.1 SPAC24C9.09 |||mitochondrial threonine-tRNA ligase|Schizosacchar... 25 8.1 SPCC737.04 |||S. pombe specific UPF0300 family protein 6|Schizos... 25 8.1 >SPCC1322.14c |vtc4||vacuolar transporter chaperone |Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 381 RDTDLQY*QPNNITKIKYYYCKNL 310 R T + PNN+T++K Y K+L Sbjct: 194 RQTTKYWVHPNNVTELKIYILKHL 217 >SPAC24C9.09 |||mitochondrial threonine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 473 Score = 25.4 bits (53), Expect = 8.1 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = -3 Query: 479 VNRLQLHRPFNVMCNEDEPHTPSL---PLLTSIDKLETLTCSTN---SLTILQKLNTTT 321 + + QLH PF CN E +T P T + L+ + N ++ QKL TT+ Sbjct: 3 LKKFQLHTPFAHSCNRVEIYTARFGPTPFSTKANNLKQPESTLNDHRTIAARQKLYTTS 61 >SPCC737.04 |||S. pombe specific UPF0300 family protein 6|Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 225 D*LITRQLHTYPHHNVRSHRGDVTPFPSAI 136 D L T+++ Y HN+ + D+TP+P I Sbjct: 393 DSLETKEMF-YLRHNIAGFQADLTPYPMRI 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,916,481 Number of Sequences: 5004 Number of extensions: 58957 Number of successful extensions: 122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -