BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30985 (715 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0958 + 9532423-9533202 31 1.2 05_01_0479 - 3920992-3921513,3921643-3921756,3921905-3922482,392... 28 8.5 >08_01_0958 + 9532423-9533202 Length = 259 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 413 LGCEVRLHYT*H*KGDAAAAYSHCIGIIV 499 LGC +RLH H GDAAA C G ++ Sbjct: 16 LGCMLRLHVVEHPTGDAAAVAFQCDGCML 44 >05_01_0479 - 3920992-3921513,3921643-3921756,3921905-3922482, 3922709-3923067,3923132-3923205 Length = 548 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 230 YVINLSRVSYIPIHITMCDHTGEMLHLFLPPL 135 Y+ N + VSY P+H H G++ L P L Sbjct: 493 YIANSNHVSYFPVHAITKLHEGDVQSLVDPKL 524 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,423,293 Number of Sequences: 37544 Number of extensions: 357521 Number of successful extensions: 575 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -