BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30985 (715 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 26 0.31 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.54 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 6.6 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 26.2 bits (55), Expect = 0.31 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -3 Query: 464 LHRPFNVMCNEDEPHTPSLPLLTSIDKLETLTCSTNS 354 + RPF V +P+T + +L S+D+L+ L N+ Sbjct: 460 MSRPFEVRY---DPYTQRVEILDSVDRLDNLMAQVNT 493 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.54 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = -3 Query: 470 LQLHRPFNVMCNEDEPHTPSLPLLTSIDKLETLTCSTNSLTILQKLNTT 324 ++ R ++ PH P P T T T +T + T NTT Sbjct: 633 MERERDASLSSTHSHPHEPGAPATTITTITTTTTTTTTTTTTTTTPNTT 681 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 88 SWGITYNFVFF 120 SW IT+NF +F Sbjct: 209 SWRITHNFFYF 219 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,534 Number of Sequences: 438 Number of extensions: 4664 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -