BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30984 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 0.86 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.6 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 8 PHGSTFRLGADSGRFSQCCSRPPCEQR 88 P+G T G D G + CS PCE + Sbjct: 88 PYGYT---GKDCGEYVDWCSTNPCENQ 111 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 428 IAQTGPVRKEVKDQSNGDKAXXXXXXXQVFYFNYLHSHSVIF 553 + Q+ P + KD +GDK + + N LHS F Sbjct: 70 VIQSVPHPETEKDWGDGDKHDRHERHFESSFGNNLHSEKAKF 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,842 Number of Sequences: 336 Number of extensions: 3385 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -