BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30984 (605 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 26 4.9 SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyc... 25 8.6 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.8 bits (54), Expect = 4.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 75 LVSREYYRPWRHLAAAARDLGSSIKSDKDKFQV 173 L++ Y + W+ L++ + + S SDKD Q+ Sbjct: 358 LLNGRYKKRWQQLSSEVKKISDSASSDKDVKQL 390 >SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyces pombe|chr 1|||Manual Length = 349 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/53 (24%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 201 EEISVKTAD-GYIVVEGKHRRRKISMVTYRVNSLVATLCRRAVRLNLWSPGCL 356 E +K D G ++ +S YR ++ T + V +++WS GC+ Sbjct: 151 ENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCI 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,506,658 Number of Sequences: 5004 Number of extensions: 51427 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -