BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30984 (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 50 2e-06 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 43 2e-04 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 37 0.015 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 37 0.015 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 37 0.015 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 35 0.044 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 34 0.10 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 31 0.72 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 30 1.3 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) 28 6.7 SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_18926| Best HMM Match : Colipase_C (HMM E-Value=0.0043) 28 6.7 SB_75| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_54295| Best HMM Match : RVP (HMM E-Value=0.037) 28 6.7 SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_50579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_45669| Best HMM Match : RVT_1 (HMM E-Value=0.14) 27 8.9 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = +2 Query: 254 QEKKDQHGYISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVEGERKIP 427 Q + + G+ S++F R Y LPEG S+ +R++ DG+L V A +K PPA E K P Sbjct: 36 QRHESEEGFDSKEFRRCYNLPEGVDESSISTRIAEDGMLHVEALKKSPPATT-ENKAP 92 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 153 DKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKHR 257 D DKFQ+ LDV+ F PEEI+ K +G I V G R Sbjct: 2 DADKFQIATLDVREFKPEEITCKVENGKIKVSGLQR 37 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +2 Query: 248 QTQEKKDQHGYIS-RQFTRRYALPEGCTAESVESRLSSDGVLSVIAPRK 391 + +++ ++HG+ + RQF R + LP +++ RL DGVL + A ++ Sbjct: 126 RARQECEEHGFFTARQFNRHFVLPREVDMDTLVPRLGKDGVLYIEADKR 174 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 153 DKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHRRRKISMVTYR 287 D KF + LDV F PEE+ VK + V + + T R Sbjct: 96 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTAR 140 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +2 Query: 257 EKKDQHGYISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVE 409 + + +HGY + +F R Y LP+G +V SR++ DG+L + A + P E Sbjct: 71 KSEGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEALKAEPQETE 121 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/43 (39%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = +3 Query: 132 LGSSIKSDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKHR 257 L ++ + + DK ++ LDV+++ PEEIS+K G I ++GKH+ Sbjct: 29 LAANTEMEGDKVEIATLDVKNYRPEEISLKVEHGRIKIDGKHK 71 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 299 RRYALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVEGERKIPI 430 R + LP+ +S+ SRL DG L + A R + P ER++ I Sbjct: 161 RHFVLPKDVDMDSLVSRLGKDGKLYIEAKRILHPTPH-ERQVNI 203 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/36 (38%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 150 SDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 ++++K ++ LDV+ + PEEIS K +G++ V+G+H Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH 37 Score = 35.9 bits (79), Expect = 0.025 Identities = 14/33 (42%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +3 Query: 159 DKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 D+ ++ LDV+ + PEEIS K +G++ V+G+H Sbjct: 239 DELEIAKLDVREYRPEEISFKVENGFVKVQGRH 271 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 129 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 D G DKF + +DV F P+ I V+ ++V H Sbjct: 87 DGGEEESKGDDKFSMAMDVTGFPPDSIKVQVLGNELLVSANH 128 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 129 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 D G DKF + +DV F P+ I V+ ++V H Sbjct: 321 DGGEEESKGDDKFSMAMDVTGFPPDSIKVQVLGNELLVSANH 362 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/36 (38%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 150 SDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 ++++K ++ LDV+ + PEEIS K +G++ V+G+H Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH 37 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 129 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 D G DKF + +DV F P+ I V+ ++V H Sbjct: 87 DGGEEESKGDDKFSMAMDVTGFPPDSIKVQVLGNELLVSANH 128 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/36 (38%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 150 SDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 ++++K ++ LDV+ + PEEIS K +G++ V+G+H Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH 37 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 129 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 D G DKF + +DV F P+ I V+ ++V H Sbjct: 87 DGGEEESKGDDKFSMAMDVTGFPPDSIKVQVLGNELLVSANH 128 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/36 (38%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 150 SDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 ++++K ++ LDV+ + PEEIS K +G++ V+G+H Sbjct: 2 ANENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH 37 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 129 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 D G DKF + +DV F P+ I V+ ++V H Sbjct: 87 DGGEEESKGDDKFSMAMDVTGFPPDSIKVQVLGNELLVSANH 128 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 35.1 bits (77), Expect = 0.044 Identities = 14/36 (38%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +3 Query: 150 SDKDKFQV-NLDVQHFAPEEISVKTADGYIVVEGKH 254 ++++K ++ LDV+ + PEEIS K +G + V+G+H Sbjct: 3 NNENKLEIAKLDVREYRPEEISFKVENGVVKVQGRH 38 Score = 32.3 bits (70), Expect = 0.31 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 135 GSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 G+ +S DKF + +DV+ F PE I V+ ++V H Sbjct: 89 GAKKESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANH 128 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 177 LDVQHFAPEEISVKTADGYIVVEGKH 254 LDV+ + PEEIS K +G + V+G+H Sbjct: 12 LDVKEYRPEEISFKVENGVVKVQGRH 37 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 147 KSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKH 254 K+ +DKF + +DV F PE I V+ ++V H Sbjct: 92 KAKEDKFSMAIDVAGFPPESIKVQVLGNELLVNANH 127 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +3 Query: 120 AARDLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHRRRKISMVTYR 287 A ++ S+ D KF + LDV F PEE+ VK + V + + T R Sbjct: 13 ATKENQSAATKDDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTAR 68 >SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) Length = 385 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 479 RRWIGPSPPCARVRFGRSESCVHPPL--LAAPSWVRLQTTHHLKTAG 345 + W P P V FG + C+H P+ L A W+ QTT KT G Sbjct: 134 KSWSQPFP----VNFGVRQGCIHSPILFLVAIDWIMRQTTSD-KTRG 175 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 380 APRKVPPAVEGERKIPIAQTGP 445 +PR V P V ER+I ++Q+GP Sbjct: 1384 SPRSVKPVVRSERRIKLSQSGP 1405 >SB_47661| Best HMM Match : zf-CCHC (HMM E-Value=0.015) Length = 830 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 147 KSDKDKFQVNLDVQHFAPEEISVKTADGYI-----VVEGKHRRRKISMVTYRVNSLVATL 311 + D +KF+ + D+Q + + A+G I +V + +RKI + +++ L T Sbjct: 702 RCDWEKFRRDKDIQPYYQVRQELSVAEGLIFREERIVLPEVLQRKIVKIGHKMGHLGKTK 761 Query: 312 CRRAVRLNLWSPGCLQMV 365 ++ +R W P M+ Sbjct: 762 TKQMLREKYWFPNMNSMI 779 >SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 146 DAGAKVSSRGSKVTPRAVVFSAHKGAGCSTEKIFRSQPQ 30 D A V + S V+ FS H G+ CST + ++P+ Sbjct: 154 DVLAAVKTPVSPVSSNGTAFSEHGGSPCSTPTVSSAEPR 192 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 147 KSDKDKFQVNLDVQHFAPEEISVKTADGYI-----VVEGKHRRRKISMVTYRVNSLVATL 311 + D +KF+ + D+Q + + A+G I +V + +RKI + +++ L T Sbjct: 908 RCDWEKFRRDKDIQPYYQVRQELSVAEGLIFREERIVLPEVLQRKIVKIGHKLGHLGKTK 967 Query: 312 CRRAVRLNLWSPGCLQMV 365 ++ +R W P M+ Sbjct: 968 TKQMLREKYWFPNMNSMI 985 >SB_18926| Best HMM Match : Colipase_C (HMM E-Value=0.0043) Length = 811 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 320 GCTAESVESRLSSDGVLSVIAPRKVPPA 403 G + +S+ES++ SDG ++P K PA Sbjct: 531 GSSPQSLESQVLSDGCTKTMSPNKTSPA 558 >SB_75| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 437 FGRSESCVHPPLLAAPSWVRLQTTHHLKTAGT 342 F R+ V+PP LA P W+ + H T GT Sbjct: 31 FTRTIGKVYPPTLANPDWIHYE-EHFKTTTGT 61 >SB_54295| Best HMM Match : RVP (HMM E-Value=0.037) Length = 239 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 392 VPPAVEGERKIPIAQTGPVRKEVKD-QSNG 478 V P + RK+PI+ GPV++++ + + NG Sbjct: 156 VTPVIHPPRKLPISPLGPVKEKLSEMEQNG 185 >SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1787 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 147 KSDKDKFQVNLDVQHFAPEEISVKTADGYI-----VVEGKHRRRKISMVTYRVNSLVATL 311 + D +KF+ + D+Q + + A+G I +V + +RKI + +++ L T Sbjct: 1009 RCDWEKFRRDKDIQPYYQVRQELSVAEGLIFREERIVLPEVLQRKIVKIGHKLGHLGKTK 1068 Query: 312 CRRAVRLNLWSPGCLQMV 365 ++ +R W P M+ Sbjct: 1069 TKQMLREKYWFPNMNSMI 1086 >SB_50579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 92 LPPVASPCCRGSRPWLQHQK 151 L P SPCC+ + W+Q+ K Sbjct: 296 LKPTMSPCCKTTTTWVQNLK 315 >SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 27.5 bits (58), Expect = 8.9 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +2 Query: 248 QTQEKKDQHGYISRQFTRRYALPEGCTAESVESRLSS-DGVLSVIAPRKVPPAVEGERKI 424 +T KK+ GY + ALP GCT ES S+ + S AP + P+ + + Sbjct: 180 RTPPKKNP-GYCPMYSLFKAALPAGCTGESTPSQQAPYQSTPSQRAPYQSTPSQQAPYQS 238 Query: 425 PIAQTGPVRKEVKDQS 472 +Q P + Q+ Sbjct: 239 TPSQQAPYQSTPSQQA 254 >SB_45669| Best HMM Match : RVT_1 (HMM E-Value=0.14) Length = 682 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 147 KSDKDKFQVNLDVQHFAPEEISVKTADGYI-----VVEGKHRRRKISMVTYRVNSLVATL 311 + D +KF+ + D+Q + + A+G I +V + +RKI + +++ L T Sbjct: 594 RCDWEKFRRDKDIQPYYHVRQELSVAEGLIFREERIVLPEVLQRKIVKIGHKLGHLGKTK 653 Query: 312 CRRAVRLNLWSPGCLQMV 365 ++ +R W P M+ Sbjct: 654 TKQMLREKYWFPNMNSMI 671 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 383 VRLQTTHHLKTAGTPQIQPYSP 318 VR +T HH K P I+PY P Sbjct: 29 VRERTGHHKKCGALPSIKPYLP 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,234,290 Number of Sequences: 59808 Number of extensions: 466537 Number of successful extensions: 1346 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -