BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30982 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 2.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.8 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 3.8 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 557 SNQKGIFQ*FINTIKNLFTNKKGPFTLWIE 646 S+Q FQ IN N TNK + +W++ Sbjct: 124 SDQHKWFQMSINNTNNNNTNKYKDYYIWVD 153 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 121 GFIHKLCRHIL*CVLFR 71 G+IH L RH + C L R Sbjct: 368 GWIHHLARHAVACFLTR 384 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 595 CIYELLKNTFLIRKP*FKNFSVFLSMSDI 509 CI+ELL + L+ P F FS + ++ + Sbjct: 336 CIHELLGHMPLLADPSFAQFSQEIGLASL 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,371 Number of Sequences: 438 Number of extensions: 3118 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -