BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30982 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24750.1 68418.m02921 expressed protein 28 5.3 At4g31130.1 68417.m04419 expressed protein 27 9.3 >At5g24750.1 68418.m02921 expressed protein Length = 520 Score = 28.3 bits (60), Expect = 5.3 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 633 PYGLKCWFSVPQWQWP*WNYKW*FW 707 P G W V W WP + +W W Sbjct: 180 PIGKVSWSDVTHWMWPLFTEEWGSW 204 >At4g31130.1 68417.m04419 expressed protein Length = 195 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 132 FLRVASYISCVVIFYSAFFFEYKIKAFITHVLFET 28 +L A ++C V Y + F YK K+ VLF++ Sbjct: 57 YLSAAFLLACTVAGYKSLFISYKGKSVPNSVLFKS 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,052,322 Number of Sequences: 28952 Number of extensions: 202350 Number of successful extensions: 333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -