BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30979 (512 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IBV5 Cluster: Putative uncharacterized protein PF07_0... 32 8.8 >UniRef50_Q8IBV5 Cluster: Putative uncharacterized protein PF07_0056; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PF07_0056 - Plasmodium falciparum (isolate 3D7) Length = 1361 Score = 31.9 bits (69), Expect = 8.8 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 6/90 (6%) Frame = -2 Query: 274 YFENNFDNHSFLDFDNNFFSCAFIKSSAGAKTYN------NLQRV*DRHLHFC*TYP*SI 113 Y+ NN++N++ ++ N + F +S+ T + N+ R+ L+ Y + Sbjct: 1270 YYNNNYNNNNNINIQNEYNHIRFDDNSSSHMTQHPYSKTSNIMRINTTALNTSKNYTTDL 1329 Query: 112 IGTSRYRLVLISNIHMRYIVTAFKRSPEDV 23 T++ RL S IH + + K++ ED+ Sbjct: 1330 YQTNKSRLSTKSEIHYNSLKSQKKKNLEDL 1359 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 383,320,677 Number of Sequences: 1657284 Number of extensions: 6438212 Number of successful extensions: 10746 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10734 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -