BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30974 (798 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67040.1 68414.m07624 expressed protein ; expression supporte... 29 2.7 At3g13560.3 68416.m01706 glycosyl hydrolase family 17 protein si... 29 4.7 At3g13560.2 68416.m01705 glycosyl hydrolase family 17 protein si... 29 4.7 At3g13560.1 68416.m01704 glycosyl hydrolase family 17 protein si... 29 4.7 At5g57345.1 68418.m07164 expressed protein 28 8.3 At1g02110.1 68414.m00137 proline-rich family protein contains pr... 28 8.3 >At1g67040.1 68414.m07624 expressed protein ; expression supported by MPSS Length = 826 Score = 29.5 bits (63), Expect = 2.7 Identities = 28/80 (35%), Positives = 36/80 (45%), Gaps = 9/80 (11%) Frame = +3 Query: 399 NEFTTV-VRGHQQRQKHNKAAAYRALFS-KLILRGTRHRFTYH-----REERLIPERR-- 551 NE ++V V G + K A +RA F ++ L G R+R YH REER PE R Sbjct: 316 NEDSSVSVSGKDSTDQMVKKALHRAQFKDEMSLPGYRNRSEYHKKVLHREERFPPEARSF 375 Query: 552 GARGDEGCSGNAERMYSCNK 611 CS A + S K Sbjct: 376 ALPSKRSCSSPANAINSKEK 395 >At3g13560.3 68416.m01706 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase GI:15150341 from [Camellia sinensis] Length = 505 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 555 PPDALG*ASPLGG 517 PPDALG ASPLGG Sbjct: 460 PPDALGPASPLGG 472 >At3g13560.2 68416.m01705 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase GI:15150341 from [Camellia sinensis] Length = 505 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 555 PPDALG*ASPLGG 517 PPDALG ASPLGG Sbjct: 460 PPDALGPASPLGG 472 >At3g13560.1 68416.m01704 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase GI:15150341 from [Camellia sinensis] Length = 505 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 555 PPDALG*ASPLGG 517 PPDALG ASPLGG Sbjct: 460 PPDALGPASPLGG 472 >At5g57345.1 68418.m07164 expressed protein Length = 188 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 216 AFISFRRMYVSN*I-FEHDFHPLQNVGLTR 130 A S R+ ++SN F+H F P NV LTR Sbjct: 5 AIASSRQSFLSNNFSFQHSFKPKSNVNLTR 34 >At1g02110.1 68414.m00137 proline-rich family protein contains proline-rich domain, INTERPRO:IPR000694 Length = 679 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 607 LHEYI-LSALPLHPSSPRAPRRSGMSLSSRWYVNLWRVPLKISFE 476 LH + LS +PL P+ R +L W +L RVP ++ E Sbjct: 497 LHAWFKLSLVPLSNGDPKKQRPDSFALCEEWKQSLERVPDTVASE 541 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,279,076 Number of Sequences: 28952 Number of extensions: 306743 Number of successful extensions: 934 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -