BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30972 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_55028| Best HMM Match : Dynamitin (HMM E-Value=0.66) 27 9.2 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 406 SQPSPCFLLFNLPIYLRSQCLRTFRLSPNSPAGTPQSPTPLP 281 + P C +NL + RSQ + + P+ P G P P PLP Sbjct: 191 TSPGLCNQGYNL--HQRSQPVHSMEPFPDQPPGPPPGPPPLP 230 >SB_55028| Best HMM Match : Dynamitin (HMM E-Value=0.66) Length = 1709 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -2 Query: 415 EVCSQPSPCFLLFNLPIYLRSQCLRTFRLSPNSPAGTPQSPTPLPRLLVIVRE 257 EVCS PSP F L +L ++ + +T + P+ S P L+ +++E Sbjct: 276 EVCSAPSPQFSLSSLSLHWQWFVEKTLAVVPHILGQATDSSLP-SELVTLIKE 327 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,733,362 Number of Sequences: 59808 Number of extensions: 400271 Number of successful extensions: 966 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -