BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30972 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 27 0.64 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.0 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 4.5 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 7.9 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 23 7.9 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 26.6 bits (56), Expect = 0.64 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 352 QCLRTFRLSPNSPAGTPQSPTPLPRLLVIVRERP 251 Q L+ ++ PN A + QSP P+ R V+ + P Sbjct: 1560 QKLKRGKIEPNGVASSSQSPAPVRREFVMHNKAP 1593 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 7 FNVQNANLTFVLLAAILGTALAVGQYY 87 FNV L F L+ AI+G L G+Y+ Sbjct: 1435 FNVLLVCLIFWLIFAIMGVQLFAGKYF 1461 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -2 Query: 313 AGTPQSPTPLPRLLVIVRERPSPLYVL 233 +G +S L +L +++ +P+PLY+L Sbjct: 1084 SGGQRSLVALSLILAMLKYKPAPLYIL 1110 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 397 SPCFLLFNLPIYLRSQCLRTFR 332 SP L +LP R +C +TFR Sbjct: 306 SPIKLKLSLPYVEREKCSKTFR 327 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 328 SPNSPAGTPQSPTPLPR 278 S + A TP +PTP PR Sbjct: 76 SSHRAAATPTTPTPQPR 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,854 Number of Sequences: 2352 Number of extensions: 12690 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -