BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30968 (761 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 25 3.4 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 5.9 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 23 7.8 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.8 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 654 HPGRNWLLSSQGLEQFLVF*KNIPAIT 734 HP W ++++G+E+ F KN P +T Sbjct: 193 HPSL-WAIAAKGMEEIAEFEKNPPDLT 218 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -3 Query: 756 WLNYFNGW*WQVYFFKIPK---IVPALVM 679 W++ W WQ+Y + +VPAL++ Sbjct: 375 WIDLVEAWRWQLYMCWVSGSLFVVPALII 403 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 56 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 94 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 56 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 94 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 53 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 91 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 67 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 105 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 52 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 90 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 52 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 90 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 65 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 103 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 66 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 104 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 66 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 104 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 64 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 102 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.8 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 6/39 (15%) Frame = +1 Query: 43 QSIKMKIYKDI--ITGDEM----FSDTYKMKLVDEVIYE 141 Q ++ ++Y ++ I GD F DT +MK ++ VI+E Sbjct: 28 QHVQEQVYAELRQIFGDSKRKATFGDTLEMKYLERVIFE 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,027 Number of Sequences: 2352 Number of extensions: 16179 Number of successful extensions: 80 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -