BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30967 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53502| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) 29 3.8 >SB_53502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 128 NTEP-IPILNQEQVINPDGSYKWSYETGNGISAEEQGYIKNQGNLNKRRRRHR 283 ++EP +PI N++++I S + E ++ +EQ Y+K NL + + + Sbjct: 224 DSEPEVPIYNRQELIEKYHSDERQQEVEKNVTDQEQRYLKYMSNLEELQNEEK 276 >SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) Length = 580 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 146 ILNQEQVINPDGSYKWSYETGNGISAEEQ 232 ++N +IN DG+Y+ E G G+S Q Sbjct: 533 VMNDLSIINSDGTYQEGAEPGQGVSLNVQ 561 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,864,727 Number of Sequences: 59808 Number of extensions: 249292 Number of successful extensions: 361 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -