BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30967 (603 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical ... 34 0.090 Z47074-1|CAA87375.2| 851|Caenorhabditis elegans Hypothetical pr... 28 5.9 >AL032652-4|CAB63398.1| 486|Caenorhabditis elegans Hypothetical protein Y63D3A.5 protein. Length = 486 Score = 33.9 bits (74), Expect = 0.090 Identities = 19/76 (25%), Positives = 34/76 (44%) Frame = +2 Query: 11 SSFQQFQHQPNYLQQVQPINSLYAKXXXXXXXXXXXTVHNTEPIPILNQEQVINPDGSYK 190 S +QF H+P ++++ P+ + YA T +++P P + Q I P + Sbjct: 177 SVHEQFNHRPAHVEEEIPLENHYAPPPHQQIPDDLNTSFSSQPPPPIEQFGAIPPPNATI 236 Query: 191 WSYETGNGISAEEQGY 238 S+ T N S Q + Sbjct: 237 PSFPTSNAASPPVQEF 252 >Z47074-1|CAA87375.2| 851|Caenorhabditis elegans Hypothetical protein K07C10.1 protein. Length = 851 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 217 NSISCLVTPLI*SIGIDDLFLI 152 NSI C+ LI IG+DD FL+ Sbjct: 320 NSIMCITPFLILGIGVDDAFLL 341 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,379,651 Number of Sequences: 27780 Number of extensions: 199417 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -