SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30967
         (603 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    34   0.001
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    28   0.081
EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.    22   5.3  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    22   5.3  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 33.9 bits (74), Expect = 0.001
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 146 ILNQEQVINPDGSYKWSYETGNGISAEEQGYIKNQGN 256
           I +Q+  +N DG+Y  ++ET NGIS +E G  K   N
Sbjct: 29  ITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDN 65


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 27.9 bits (59), Expect = 0.081
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +2

Query: 443 YAATKLCNCDVNCIESLI 496
           Y   K CNCD++CI  ++
Sbjct: 472 YECNKRCNCDIDCINRVV 489


>EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.
          Length = 200

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 172 IDDLFLIKYGNRF 134
           IDD FL K G+RF
Sbjct: 165 IDDHFLFKEGDRF 177


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 172 IDDLFLIKYGNRF 134
           IDD FL K G+RF
Sbjct: 181 IDDHFLFKEGDRF 193


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,809
Number of Sequences: 438
Number of extensions: 2570
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17726685
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -