BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30967 (603 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48630.1 68416.m05309 hypothetical protein hypothetical prote... 28 4.1 At5g28310.1 68418.m03437 oxidoreductase-related low similarity t... 27 9.6 >At3g48630.1 68416.m05309 hypothetical protein hypothetical protein - Arabidopsis thaliana, EMBL:AC006438.2 Length = 122 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 290 YWPCAVCASCSGFPGFLC 237 YW VCASC G F+C Sbjct: 32 YWKRDVCASCKGNQNFVC 49 >At5g28310.1 68418.m03437 oxidoreductase-related low similarity to glyoxylate reductase from Thermococcus litoralis [gi:13515409] Length = 233 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -3 Query: 415 NRSRKIITSNKKILKVQRSIQINTAKLR*DNNLLDRQAQYIDIGPVPSAPLVQVSL 248 NR +++ +K + +R +Q N + DN L +++ P P+ L Q SL Sbjct: 10 NRIKRVYRETRKEQRFERQMQQNRGQTGVDNQDLKSNIVVVEVSPSPT--LAQASL 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,604,655 Number of Sequences: 28952 Number of extensions: 178597 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -