SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30963
         (618 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    25   0.67 
AY490815-1|AAR82970.1|  136|Tribolium castaneum glass protein pr...    22   3.6  
AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein pr...    22   3.6  

>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 24.6 bits (51), Expect = 0.67
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 102 SAGTSPPPMHATRSARSPRVVSEPYTAPVNNFTNL 206
           S  +SPPP +   +  +P         PV N TNL
Sbjct: 325 SLTSSPPPPYQISAQPTPSQSPNQIYQPVTNLTNL 359


>AY490815-1|AAR82970.1|  136|Tribolium castaneum glass protein
           protein.
          Length = 136

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 309 KPYRCLSCVPRF 344
           KPYRC+ C   F
Sbjct: 20  KPYRCIDCNKSF 31



 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 309 KPYRCLSCVPRF 344
           KPY C  C+ RF
Sbjct: 104 KPYECKLCLLRF 115


>AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein
           protein.
          Length = 392

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 309 KPYRCLSCVPRF 344
           KPYRC+ C   F
Sbjct: 276 KPYRCIDCNKSF 287



 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 309 KPYRCLSCVPRF 344
           KPY C  C+ RF
Sbjct: 360 KPYECKLCLLRF 371


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,443
Number of Sequences: 336
Number of extensions: 2631
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15770591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -