BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30963 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosac... 26 3.8 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 25 8.8 >SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1630 Score = 26.2 bits (55), Expect = 3.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 342 SGAHRTNNGTVCDFRRKRIIVIPSC 268 S AHR N +C F+ +II+I C Sbjct: 740 SSAHRPYNSLLCAFQSLKIILIRLC 764 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 25.0 bits (52), Expect = 8.8 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 87 KTVIVSAGTSPPPMHATRSARSPRVVSEPYTAPVNN 194 K + + P P T +A SP +S+P +APV N Sbjct: 1052 KQATTVSASKPAPSTVTSAASSPSNISKP-SAPVAN 1086 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,175,803 Number of Sequences: 5004 Number of extensions: 38146 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -