BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30962 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 77 1e-14 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 48 9e-06 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 47 1e-05 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 42 3e-04 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 6e-04 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 6e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 41 0.001 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 39 0.003 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 38 0.007 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 37 0.013 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 37 0.017 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 36 0.022 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 36 0.029 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 33 0.21 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 33 0.27 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 31 0.63 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 29 3.4 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_1995| Best HMM Match : Acyltransferase (HMM E-Value=0.00021) 29 4.5 SB_53078| Best HMM Match : Acyltransferase (HMM E-Value=2.8026e-45) 29 4.5 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 77.4 bits (182), Expect = 1e-14 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = +2 Query: 38 KKVKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDKTEW 205 KK K + PKR MSAYMLWLN R++IK + PG+ VTE++K GE+WK++ DK++W Sbjct: 534 KKKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKW 589 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +2 Query: 53 TDKP--KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 T KP KRPM+A+M+W +AR ++ + P L E++K G++WK + D Sbjct: 59 TQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLND 107 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +2 Query: 44 VKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 VK + KRPM+A+M+W R +I E P + +EI+K+ G WK + D Sbjct: 321 VKPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 370 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +2 Query: 44 VKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 VK + KRPM+A+M+W R +I E P + +EI+K+ G WK + D Sbjct: 4 VKPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 53 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/52 (32%), Positives = 31/52 (59%) Frame = +2 Query: 41 KVKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 K D+ KRPM+A+M+W R ++ + P + +EI+K+ G WK + ++ Sbjct: 782 KANSADRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQ 833 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +2 Query: 35 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM--KDKTEW 205 +K+ K +KPKR +SAY ++N R+ +K + P ++K GE+W M DKT++ Sbjct: 93 KKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQY 151 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +2 Query: 47 KMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 K +KPK SAY +L RE+++ E + + +K E WK+M ++ Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEE 56 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/47 (34%), Positives = 30/47 (63%) Frame = +2 Query: 47 KMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 K K KRPM+++M+W SAR ++ + P + E++K G++W+ + Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRML 152 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 47 KMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 K D KRPM+AYM+W R +I E P + +EI+K+ G W S+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSL 49 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 42.3 bits (95), Expect = 3e-04 Identities = 15/54 (27%), Positives = 34/54 (62%) Frame = +2 Query: 35 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 ++K K+ +P +P+SAY ++ + I+ + P + EIAK G++W+++ ++ Sbjct: 916 KRKTKIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEE 969 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKS-EXPGLRVTEIAKKGGEIWKSMKDK 196 KRPM+A+M+W + R +IKS E P + +EI+K G WK+MKD+ Sbjct: 10 KRPMNAFMVW-SKERRRIKSQECPRMHNSEISKILGCEWKAMKDE 53 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 38 KKVKMTDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 KK KRPM+A+M+W R ++ E P + EI+K+ G+ WK + + Sbjct: 37 KKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSE 88 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +2 Query: 35 RKKVKMTDKPKRPMSAYMLW---LNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 RKK +KPK P++ Y+ + LNS RE +K + P L EI K G+ W S+ Sbjct: 185 RKKEYDLNKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSL 238 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 KRPM+A+M+W + R Q+ +E P L ++I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 KRPM+A+M+W + R Q+ +E P L ++I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 56 DKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 D KRP++++M+W R + E P +R EI+K G+ W+ M + Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPE 53 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +2 Query: 59 KPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDKTE 202 K KRPM+A+M+W R I P EI+ + GEIW + + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 KRPM+++M+W R + E P L EI+K G+ W + K Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTK 138 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 KRPM+ +M+W R QI E PG+ ++K G WK + Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKL 49 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 53 TDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 T++ KRPM+A+M+W R ++ P L E++K G W+++ Sbjct: 363 TERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/48 (31%), Positives = 30/48 (62%) Frame = +2 Query: 53 TDKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 ++K KRP++A++LW R I +E P + +I++K G W+ + ++ Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEE 63 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 37.1 bits (82), Expect = 0.013 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +2 Query: 8 KNYFKIFAIRKKVKMTDKPKRPMSAYMLWLNSAREQI--KSEXPGLRVTEIAKKGGEIWK 181 + Y K K DKPKRP +AY L+L + R+++ K+ G ++ +A GE W+ Sbjct: 559 QRYLKESGKNDPKKDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSLA---GERWR 615 Query: 182 SMKDK 196 M D+ Sbjct: 616 EMSDE 620 Score = 32.7 bits (71), Expect = 0.27 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +2 Query: 35 RKKVKMTDKP--KRPMSAYMLWLNSAREQIKSEX-----PGLRVTEIAKKGGEIWKSMKD 193 RKK D P KR SAY+ + + R ++K++ P + E+AK GE WK + D Sbjct: 485 RKKKAKGDGPVVKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLND 544 Query: 194 K 196 + Sbjct: 545 E 545 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 36.7 bits (81), Expect = 0.017 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +2 Query: 62 PKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKD 193 P++P+ YM + +Q+K++ P ++ +I K G++W+ + D Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDD 71 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 36.3 bits (80), Expect = 0.022 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +2 Query: 56 DKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 ++PK P+++Y + R ++ + P L+ TE+A K + W+ M ++ Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEE 196 Score = 35.1 bits (77), Expect = 0.051 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 71 PMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 P+SA+ LW N AR+ + P + ++ KK WK + +K Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEK 271 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 35.9 bits (79), Expect = 0.029 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMKDK 196 KRPM+A+M+W + R ++ + P + EI+K G W + ++ Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEE 53 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 56 DKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSMK--DKTEW 205 D+ + + + LWL R+QI+ E P + ++ K + WK + +K W Sbjct: 327 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVW 378 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 32.7 bits (71), Expect = 0.27 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 56 DKPKRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 D+ + + + LWL R+QI+ E P + ++ K + WK + Sbjct: 34 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGL 77 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKSM 187 K PM+A+M+ R+ S PG+ +E +K G WK + Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKML 50 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKS 184 KR S Y+L+ + R I+ E P EI++ GE W++ Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 75 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 65 KRPMSAYMLWLNSAREQIKSEXPGLRVTEIAKKGGEIWKS 184 KR S Y+L+ + R I+ E P EI++ GE W++ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 1308 >SB_1995| Best HMM Match : Acyltransferase (HMM E-Value=0.00021) Length = 127 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -1 Query: 661 IITKHYNIRKI*RNIESRNELFNCIL*TKYQLQLKMIPTLIKC 533 I +K++ +R + +E+ E NCI+ + +Q L M P L C Sbjct: 32 ISSKYFRVRVEAKGLENLPENKNCIIVSNHQSSLDMFPILRIC 74 >SB_53078| Best HMM Match : Acyltransferase (HMM E-Value=2.8026e-45) Length = 218 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -1 Query: 661 IITKHYNIRKI*RNIESRNELFNCIL*TKYQLQLKMIPTLIKC 533 I +K++ +R + +E+ E NCI+ + +Q L M P L C Sbjct: 32 ISSKYFRVRVEAKGLENLPENKNCIIVSNHQSSLDMFPILRIC 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,209,646 Number of Sequences: 59808 Number of extensions: 248886 Number of successful extensions: 566 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -