BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30961 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98) 33 0.17 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_58726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 28 6.4 SB_25038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_52008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_32254| Best HMM Match : zf-TRAF (HMM E-Value=2.5) 28 8.5 SB_30944| Best HMM Match : FlaG (HMM E-Value=1.2) 28 8.5 SB_24871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_10112| Best HMM Match : zf-TRAF (HMM E-Value=2.5) 28 8.5 >SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98) Length = 242 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +1 Query: 409 EIPDAEAKSADIKVEEPAAQPEDSKTEVQATVAEFQ 516 E P EA+S D KVE P + E + EV+ATV E + Sbjct: 22 ETPIEEAESPDKKVEAPIEEAEAPEEEVEATVEEVE 57 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +1 Query: 430 KSADIKVEEPAAQPEDSKTEVQ---ATVAEFQKKKNLVLLMQKVLPTQLPSFPTW 585 ++ DI VE PA+ +KTE + A + +F++ + L+ +VL + P+ PT+ Sbjct: 781 RNEDIVVEVPASNEPAAKTEDEIRKAEMCKFEQAQEAEDLISEVLKSYAPTLPTY 835 >SB_58726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 270 SRFGFLSSVAAATSVGLTESSIL----GATSRIG*AGTTSFSSATGIA 139 SR G SSV A+SVGL + L G SR G A S G+A Sbjct: 412 SRVGLASSVGLASSVGLASRASLALRAGLASRAGLASRVGLPSCVGLA 459 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -1 Query: 270 SRFGFLSSVAAATSVGLTESSILGATSRIG*AGTTSFSSATGIA 139 SR G +S A+ VG +S +G SR+G A + +S+ G+A Sbjct: 388 SRVGLVSRAGLASRVG--RASRVGLASRVGLASSVGLASSVGLA 429 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 270 SRFGFLSSVAAATSVGLTESSILGATSRIG*AGTTSFSSATGIAKL 133 SR G +S A GL S +G SR+G A +S+ G+A L Sbjct: 496 SRVGLVSRAGLALRAGLASS--VGLVSRVGLASRVGRASSVGLASL 539 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -1 Query: 270 SRFGFLSSVAAATSVGLTESSILGATSRIG*AGTTSFSSATGIA 139 SR G S V + VGL +S +G SR+G A + +S G+A Sbjct: 442 SRAGLASRVGLPSCVGL--ASRVGLASRVGLANSVGLASRVGLA 483 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 261 GFLSSVAAATSVGLTESSILGATSRIG*AGTTSFSSATGIA 139 G S V A+ VGL S +G SR+G A + +S G+A Sbjct: 457 GLASRVGLASRVGLANS--VGLASRVGLASSVGLASRVGLA 495 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -1 Query: 270 SRFGFLSSVAAATSVGLTESSILGATSRIG*AGTTSFSSATGI 142 SR G SSV A+ VGL +S +G SR G A +S+ G+ Sbjct: 478 SRVGLASSVGLASRVGL--ASRVGLVSRAGLALRAGLASSVGL 518 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +1 Query: 403 SSEIPDAEAKSADIKVEEPAAQPEDSKTEVQATVAE 510 ++E+P +A ++ + E PAA+PE + E +A V + Sbjct: 587 TAEVPIEDADTSTEEAESPAAEPEVAVKEAEAPVED 622 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 336 VFWGYIVLFGLWYSGYLVVTNWS-RFGFLSSVAAATSVGLTESSILGA 196 V W + F W+ VT+ FGF+ S A+A S+G + + GA Sbjct: 564 VDWAQVQAFSKWFISQSAVTDQGVHFGFI-SYASAASIGFSFDADTGA 610 >SB_25038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1643 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 427 AKSADIKVEEPAAQPEDSKTEVQATVAEFQKKKNLVLLMQK 549 A AD+ EEPA++ ++TE+ E K K+L ++ Q+ Sbjct: 340 AYMADVDDEEPASESLATRTEISELYTESAKLKSLGVIHQE 380 >SB_52008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 188 LEVAPKIDDSVKPTEVAAATEERKP 262 +E A +D SV PT+V A +ER P Sbjct: 5 VEDASAVDTSVPPTDVTEAVDERPP 29 >SB_32254| Best HMM Match : zf-TRAF (HMM E-Value=2.5) Length = 364 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 188 LEVAPKIDDSVKPTEVAAATEERKP 262 +E A +D SV PT+V A +ER P Sbjct: 52 VEDASAVDTSVPPTDVTEAVDERPP 76 >SB_30944| Best HMM Match : FlaG (HMM E-Value=1.2) Length = 922 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 188 LEVAPKIDDSVKPTEVAAATEERKP 262 +E A +D SV PT+V A +ER P Sbjct: 27 VEDASAVDTSVPPTDVTEAVDERPP 51 >SB_24871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 188 LEVAPKIDDSVKPTEVAAATEERKP 262 +E A +D SV PT+V A +ER P Sbjct: 52 VEDASAVDTSVPPTDVTEAVDERPP 76 >SB_10112| Best HMM Match : zf-TRAF (HMM E-Value=2.5) Length = 175 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 188 LEVAPKIDDSVKPTEVAAATEERKP 262 +E A +D SV PT+V A +ER P Sbjct: 5 VEDASAVDTSVPPTDVTEAVDERPP 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,461,288 Number of Sequences: 59808 Number of extensions: 329201 Number of successful extensions: 1236 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1227 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -