BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30961 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.2 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.9 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 8.6 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +1 Query: 412 IPDAEAKSADIKVEEPAAQPEDSKTEVQATVAEFQKKKNLVLLMQKVLPTQL 567 +P EA ++ + +A P D ++ A Q N+ LL Q+ +P ++ Sbjct: 489 LPPREAPLVGVQPHQDSATPADQPLDLSAKPKNSQ-DNNISLLEQQKIPLRM 539 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/42 (28%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +2 Query: 224 PTEVAAATEERKPNLLQLVTTR----YPLYQRPKRTI*PQKT 337 P V+ ++ R+P ++ T+ +P Y+RP+ T P+ T Sbjct: 130 PPSVSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRAT 171 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = -1 Query: 468 LSSWFFHFNISRFC 427 +S+W +H N+++ C Sbjct: 1674 MSTWGYHHNVNKHC 1687 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 415 ESRMILLPGLFLRFSL 368 ES +LLP ++LR++L Sbjct: 249 ESEDVLLPSVYLRWNL 264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,197 Number of Sequences: 438 Number of extensions: 2889 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -