BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30960 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39455| Best HMM Match : PAN (HMM E-Value=1.5) 30 2.1 SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) 29 3.7 SB_18244| Best HMM Match : Fukutin-related (HMM E-Value=3.7) 29 4.9 SB_11179| Best HMM Match : ERM (HMM E-Value=4) 29 4.9 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 29 4.9 SB_27692| Best HMM Match : PAN (HMM E-Value=1.7) 29 6.5 SB_31798| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_39455| Best HMM Match : PAN (HMM E-Value=1.5) Length = 109 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = +3 Query: 324 YSIN---KP--CATQLCRYLNFNIYYNTTKTFTQNENYEHFVK 437 YS N KP C T LC L + YN + + +NEN++H+ K Sbjct: 67 YSFNFAVKPEECGTYLCEVL-YTDRYNDSDKYHKNENFDHYNK 108 >SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) Length = 1425 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 731 QLYYIYLSN-DLSFKGALKECSKISKGCGYVGHIFK 835 QLY Y N D GAL C + + CG +GH+ K Sbjct: 620 QLYDEYFFNVDYLTDGALAPCDRNCRVCGRIGHLAK 655 >SB_18244| Best HMM Match : Fukutin-related (HMM E-Value=3.7) Length = 540 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 249 YFVAKLCYHVYNTMFLVIFQAYHPFYLRYQL 157 Y V YHVY T + V YH + RY L Sbjct: 249 YHVYMTRYHVYMTRYHVYMTRYHVYMTRYHL 279 >SB_11179| Best HMM Match : ERM (HMM E-Value=4) Length = 407 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +3 Query: 261 DAILGSFKEASESLTRAPSS*YSINKPCATQLCRYLNFNIYYNTTKTFTQNENY 422 DAI S E E T++ + + K C Q+ RY+ + + + Q NY Sbjct: 234 DAIKNSLSEVQEDDTKSAKVKHLLRKLCVEQISRYIGRHCGLSDDEKIQQARNY 287 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 45 NGFRFKFPEDLTGVGSGITCSTLST*LDCCDSFNSGLSIDNANRMD 182 N F+F PED +G +T S T D ++F L D++ ++ Sbjct: 1181 NTFKFALPEDNSGEVDNVTTSAQETKSDAFNTFKFALPEDSSGEVN 1226 >SB_27692| Best HMM Match : PAN (HMM E-Value=1.7) Length = 109 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Frame = +3 Query: 324 YSIN---KP--CATQLCRYLNFNIYYNTTKTFTQNENYEHFVK 437 YS N KP C T LC L + YN + + NEN++H+ K Sbjct: 67 YSFNFAVKPEECGTYLCEVL-YTDRYNDSDKYHFNENFDHYHK 108 >SB_31798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 381 YYNTTKTFTQNENYEHFVKLFPHSFVNKFKFYCLNRQNR 497 Y+ +F +EN ++F +LF H N FK +N + R Sbjct: 6 YFVGNYSFVASENCKYFAQLFAHRSSNLFKAPAINYRIR 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,963,579 Number of Sequences: 59808 Number of extensions: 518661 Number of successful extensions: 991 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -