BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30951 (879 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 1.00 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 5.3 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 7.0 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.6 bits (56), Expect = 1.00 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 232 LIWSWKKFS*WYGVAGSAMSSV 167 L W+WK S W G+ G A++ + Sbjct: 2754 LEWNWKSKSLWLGMIGGALTGL 2775 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 5.3 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 299 YPKALEGPENRRVTVWCANDY--LGTSRHPTVQDAAVNAIKSYGTGAGGTRNIAGN 460 +P ++G R+ + + + G H VNA+ + G G GG+ + G+ Sbjct: 474 HPDNIDGDRMLRLAMASRHHHHRAGLHHHDLASGVVVNAVLAAGGGGGGSGCVNGS 529 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 7.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 5 VEPSVREKLWCDPDEAVRKLLPDY 76 V P ++ C+P E+ ++LLP + Sbjct: 770 VPPMGEDEAHCEPAESAKRLLPKF 793 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 988,143 Number of Sequences: 2352 Number of extensions: 21310 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -