BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30948 (799 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe... 29 1.0 SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||... 27 3.1 >SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe|chr 2|||Manual Length = 523 Score = 28.7 bits (61), Expect = 1.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 345 TKPNEKPSAVDLSICTPDLASSHSWYTSSSILAVIISRLSYPLLLDALLIKNEY 184 T+P + +D ++ TPDL W + I+A ++ P+ LD +K EY Sbjct: 259 TRPTNYGTRIDYTLATPDLL---PWVQDADIMAEVMGSDHCPVYLD---LKEEY 306 >SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1260 Score = 27.1 bits (57), Expect = 3.1 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 242 ITAKIDDE-VYQE*EEA-RSGVQ-IDKSTALGFSLGFVRLVGEPVLSKHKFCKSNISTKC 412 + K+D+E +YQ+ +E G + I S ++ V E + + F ++S+K Sbjct: 162 VEKKLDEEALYQDLKELYNEGFRSISVSLMHSYTYPLHEEVVEKIAKRIGFTDISLSSKL 221 Query: 413 TPLVSVVPQ 439 TP+V +VP+ Sbjct: 222 TPMVKIVPR 230 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,089,382 Number of Sequences: 5004 Number of extensions: 59651 Number of successful extensions: 153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 389395636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -