BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30947 (572 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 42 5e-04 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 41 8e-04 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_58371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 38 0.004 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 38 0.004 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 38 0.008 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 37 0.010 SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) 37 0.013 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 36 0.023 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 35 0.041 SB_45991| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.074) 35 0.054 SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) 34 0.095 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 33 0.13 SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) 33 0.17 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 33 0.17 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 33 0.22 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 33 0.22 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 32 0.29 SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) 32 0.29 SB_833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16) 32 0.29 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 32 0.38 SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) 31 0.51 SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 31 0.67 SB_7313| Best HMM Match : IQ (HMM E-Value=0.00059) 31 0.67 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 31 0.88 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 31 0.88 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_36409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) 30 1.2 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 30 1.2 SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) 30 1.2 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_41574| Best HMM Match : DUF164 (HMM E-Value=0.47) 30 1.5 SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) 30 1.5 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 29 2.0 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_44017| Best HMM Match : SKIP_SNW (HMM E-Value=0) 29 2.0 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 29 2.7 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) 29 2.7 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 29 2.7 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 2.7 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 29 3.6 SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 29 3.6 SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) 29 3.6 SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) 29 3.6 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 3.6 SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) 29 3.6 SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) 29 3.6 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 28 4.7 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 4.7 SB_9049| Best HMM Match : SMC_C (HMM E-Value=0.0098) 28 4.7 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 28 4.7 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_37125| Best HMM Match : DUF1542 (HMM E-Value=0.76) 28 4.7 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) 28 4.7 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 28 4.7 SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) 28 6.2 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 6.2 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_11059| Best HMM Match : KID (HMM E-Value=0.046) 28 6.2 SB_8287| Best HMM Match : UVR (HMM E-Value=0.07) 28 6.2 SB_36| Best HMM Match : E-MAP-115 (HMM E-Value=0.39) 28 6.2 SB_50165| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.1) 28 6.2 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) 28 6.2 SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) 28 6.2 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 27 8.2 SB_32785| Best HMM Match : Spectrin (HMM E-Value=6e-06) 27 8.2 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_10419| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_55906| Best HMM Match : SNARE (HMM E-Value=0.45) 27 8.2 SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) 27 8.2 SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_48386| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_30796| Best HMM Match : SNARE (HMM E-Value=0.45) 27 8.2 SB_22059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/70 (32%), Positives = 41/70 (58%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 KE+ KE L N ++ E+E+ +RN +A+NK LT+ + ++ ++ +EL G + Sbjct: 6 KEEKSKEEQAFLIN---SIRGLLDESEKLVRNLEAQNKNLTETITEERTRVNELRGKVSL 62 Query: 186 FEERVKQRDK 215 +ERV+Q K Sbjct: 63 LQERVEQEKK 72 Score = 32.3 bits (70), Expect = 0.29 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Frame = +3 Query: 3 QKEQLQKEFGVQLA---NIEKEMKSREKE--AEERLRNADAENKTLTKKLEQQTSKSSEL 167 Q EQL+ +F + E++M+ +E A +R+ A+ K K+ +Q S Sbjct: 80 QMEQLKTKFSEARSLNEGYERDMRMIREELLAIREIRDVPAKRKKFRKQQAEQAEAESSS 139 Query: 168 AGVLIKFEERVKQRDKRLEEAAAHETALRA 257 + EE++K +DK LE+ L A Sbjct: 140 SESSEDLEEKMKMKDKLLEDKYIENQRLEA 169 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 40.7 bits (91), Expect = 8e-04 Identities = 25/78 (32%), Positives = 44/78 (56%), Gaps = 3/78 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 ++EQL KE G + +++E + + + E L + ++NK L + Q + K L GV Sbjct: 1220 KREQLAKEAGAKRQKLKEEYEGKLRVIYEELVSERSKNKELMNQNNQLSQKVKLLEGVTT 1279 Query: 183 KFE---ERVKQRDKRLEE 227 K + ERVKQ +++L+E Sbjct: 1280 KQKKDIERVKQMEEKLKE 1297 Score = 32.7 bits (71), Expect = 0.22 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +3 Query: 24 EFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSK-SSELAGVL-IKFEER 197 +FGV L+ EKE++S ++E EE++ + + L K+ + K E G L + +EE Sbjct: 1194 KFGVLLSQHEKELESLKEELEEQIAK---KREQLAKEAGAKRQKLKEEYEGKLRVIYEEL 1250 Query: 198 VKQRDKRLE 224 V +R K E Sbjct: 1251 VSERSKNKE 1259 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 40.7 bits (91), Expect = 8e-04 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 2/80 (2%) Frame = +3 Query: 3 QKEQLQKE--FGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGV 176 Q++ L+KE F ++A E+E++ R+K EE R A+ E + ++ ++ EL + Sbjct: 1666 QEQLLEKERIFEEEMARRERELEERQKREEEERRVAEMEQVKVAQEQHLYAQETDELEQL 1725 Query: 177 LIKFEERVKQRDKRLEEAAA 236 +EER+++ LE + A Sbjct: 1726 KKTYEERIEREKGALEASIA 1745 >SB_58371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/54 (37%), Positives = 34/54 (62%) Frame = +3 Query: 69 REKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 R+KEAEE + EN++L +LEQ+T+ +SEL + + E+ + + R +EA Sbjct: 83 RKKEAEESYKRLVDENQSLESRLEQETTHNSELLKRITETEKHLVEIGLRKKEA 136 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 38.3 bits (85), Expect = 0.004 Identities = 20/54 (37%), Positives = 34/54 (62%) Frame = +3 Query: 69 REKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 R+KEAEE + EN++L +LEQ+T+ +SEL + + E+ + + R +EA Sbjct: 83 RKKEAEESYKRLVDENQSLESRLEQETTHNSELLKRITETEKHLVEIGLRKKEA 136 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 38.3 bits (85), Expect = 0.004 Identities = 27/75 (36%), Positives = 41/75 (54%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 Q+E+ +KE + E E+K R KE EERL A + + +KLE+Q K E Sbjct: 381 QREEARKE-EEEKRKREGEVKKR-KEEEERLVEARRKEQEEKRKLEEQKRKEEEDRRRKE 438 Query: 183 KFEERVKQRDKRLEE 227 E+R+K+ + RL+E Sbjct: 439 AEEKRIKEEEARLKE 453 Score = 27.5 bits (58), Expect = 8.2 Identities = 22/80 (27%), Positives = 45/80 (56%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 E++Q++ + IE+E + R KEAEE+ + + E + + ++++++ K + A Sbjct: 306 EEMQRKTQ-EKKRIEEEEQKR-KEAEEK-KAKEIEQRRMEEEIKKEEEKKRKEAE----- 357 Query: 189 EERVKQRDKRLEEAAAHETA 248 E+RVK+ RLE+ + A Sbjct: 358 EKRVKEEQIRLEKERKRKEA 377 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 37.5 bits (83), Expect = 0.008 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKT-LTKKLEQQTSKSSELAGVL 179 +KE+L+ + + +EK+ + +EK+ +ERL E K L KK +++ K + + Sbjct: 340 EKERLEAKQKKEQERLEKQAE-KEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEIN 398 Query: 180 IKFEERVKQRDKRLEE 227 K EE+ K+ +K+ +E Sbjct: 399 AKIEEKKKREEKKKQE 414 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 37.1 bits (82), Expect = 0.010 Identities = 23/92 (25%), Positives = 51/92 (55%), Gaps = 4/92 (4%) Frame = +3 Query: 54 KEMKSREKEAEER-LRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 K++K + K +++ + D EN+ L + LEQ + + ++ VL F+E++K +++ +E Sbjct: 215 KKLKEKRKTPDDKAMEELDMENQKLQENLEQFSVEREDMIKVLKSFKEQLKVKEQNNQEL 274 Query: 231 AAHETAL-RARSRPGT*PLSSW--RRPCWSAR 317 + L + ++ + P +S R+P +AR Sbjct: 275 QSQLAVLQKVKNEASSKPSTSQKPRKPVTAAR 306 >SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) Length = 298 Score = 36.7 bits (81), Expect = 0.013 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEE 227 ++E + REKE EERL+ A+ E + K+ E++ + EL + E R K+R +RLE+ Sbjct: 92 DREKRRREKEEEERLKRAEEEKRREEKRREEK-RREEELKRERKEQERREKER-QRLEK 148 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 36.7 bits (81), Expect = 0.013 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 8/92 (8%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSR--EKE-AEERLRNA-DAENKTLTKKLEQQTSKSSELA 170 +K +L+++ +L ++EKE ++R E+E AE L+ D E K L KL ++ + EL Sbjct: 1366 EKSKLEEQLKQRLLDMEKESQNRLLEREKAEADLKEKFDLEEKALLDKLAEKENSEHELM 1425 Query: 171 GVLIKFEE----RVKQRDKRLEEAAAHETALR 254 + E+ ++ Q+DK +EE A A++ Sbjct: 1426 QRIESTEQENQAKLNQKDKSIEELQASLDAVK 1457 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 + Q +KE ++ + EKE+++ E E+R A ++T+T + Q + + ++ Sbjct: 1477 EMNQAKKELEIKYSTKEKELRA---ELEKREVQAKQTSETMTANISQLNEREKKHKQEML 1533 Query: 183 KFEERVKQRDKRLEE 227 E K++ +EE Sbjct: 1534 VLENNWKEKYSEIEE 1548 Score = 28.3 bits (60), Expect = 4.7 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 6/91 (6%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMK---SREKEAEERLRN--ADAENKTLTKKLEQQTSKSSEL 167 Q +QL KEF ++ E+E++ S EA +R N D + + + ++ + E+ Sbjct: 1936 QVKQLLKEFHIKYGEKERELQDTVSNAIEASQREENKLVDKYEEEIREYRKELKMREDEM 1995 Query: 168 AGVLIKFEERVKQRDKRLEE-AAAHETALRA 257 +++V++ ++ +EE HE AL A Sbjct: 1996 LDYKRITDQKVQESEQMVEELKKQHEDALLA 2026 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 35.9 bits (79), Expect = 0.023 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = +3 Query: 51 EKEMKSREK-EAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEE 227 E+E +REK E EE+LR + K +KLE + + + + EER KQ +KR E Sbjct: 265 EEEKAAREKAEMEEKLRRLKLQEKEEKRKLEAEKKEKERVERE--QREERRKQEEKRRAE 322 Query: 228 AAAHETALRARS 263 A A R+ Sbjct: 323 EQARRKAEEERA 334 Score = 35.1 bits (77), Expect = 0.041 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 6/81 (7%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKK--LEQQTSKSSELAGVL 179 K Q +E +L ++ E + + K+ ERLR E K ++ +EQ+ +++ E+ L Sbjct: 564 KAQKLEEEQRELERLQAEAELKRKQELERLREKRKEEKAQRERELIEQEKNRAREIYISL 623 Query: 180 IKFEERVKQRD----KRLEEA 230 + E+VKQ++ ++LEEA Sbjct: 624 KRVREQVKQKEAEEQRKLEEA 644 Score = 27.9 bits (59), Expect = 6.2 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 4/91 (4%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEK----EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELA 170 +KE++++E + E+ E ++R K EER A AE + +KLE++ + A Sbjct: 300 EKERVEREQREERRKQEEKRRAEEQARRKAEEERAAKAKAEMEERMRKLEEKREAERQEA 359 Query: 171 GVLIKFEERVKQRDKRLEEAAAHETALRARS 263 + I + + + K E A + A R R+ Sbjct: 360 -LRIDRDRKQDAQKKVAEHVARLQEAERRRA 389 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 35.1 bits (77), Expect = 0.041 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKE--AEERLRNADAENKTLTKKLEQQTSKSSELAGV 176 ++E+ +KE + +EKE K +EK+ E+ R + + + L +K E++ K +E A Sbjct: 916 KREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAK- 974 Query: 177 LIKFEERVKQRDKRLEE 227 K +ER+ Q DK E+ Sbjct: 975 --KEKERLLQEDKLHEK 989 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQ---TSKSSELAGVLIKFEERVKQRDK-RL 221 KEMK +EK +E+ E + +K QQ K + +LI+ E+R K++ K RL Sbjct: 899 KEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKERL 958 Query: 222 EEAAAHE 242 E E Sbjct: 959 REKEEKE 965 Score = 28.3 bits (60), Expect = 4.7 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 3/72 (4%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSRE-KEAEERLRNADAENKTLTKKL--EQQTSKSSELAGV 176 KE KE ++ EK+ + RE KE + R + + E K KKL E++ + + Sbjct: 899 KEMKDKE-KIEKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKER 957 Query: 177 LIKFEERVKQRD 212 L + EE+ KQ++ Sbjct: 958 LREKEEKEKQKE 969 Score = 27.5 bits (58), Expect = 8.2 Identities = 24/88 (27%), Positives = 46/88 (52%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +KE+ +KE + IEKE + +EK+ +ERLR + + K +K ++ K E Sbjct: 932 EKEKKEKE---KKLLIEKEKREKEKQ-KERLREKEEKEK---QKEAERAKKEKERLLQED 984 Query: 183 KFEERVKQRDKRLEEAAAHETALRARSR 266 K E+ +++D++ +E E R + + Sbjct: 985 KLHEK-EEKDRKDKEKRKVEKEKREKDK 1011 >SB_45991| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.074) Length = 134 Score = 34.7 bits (76), Expect = 0.054 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEE 194 +EMK +E+ E+++ AENK LT+ L++ + EL L +E+ Sbjct: 4 EEMKKKEERMEKQMNEIMAENKRLTEPLQKAREEVEELRKQLANYEK 50 >SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) Length = 311 Score = 33.9 bits (74), Expect = 0.095 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 3/81 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEK---EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAG 173 Q EQ E GV+ N+E+ E++S+ K+ ++ A AE L+ K E+ + E+ Sbjct: 80 QMEQRMAEIGVEKGNVERSLEEVQSQNKDLMQQAERAKAELAKLSAKYEELEDEKDEMQE 139 Query: 174 VLIKFEERVKQRDKRLEEAAA 236 L + ++++ + + + A Sbjct: 140 SL---SDTIREKSREIRDLEA 157 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/74 (21%), Positives = 39/74 (52%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 QK++++K F +++ ++ K+ E+ L + K L +++ ++ K+ I Sbjct: 1047 QKKEMKKSFKRSKGDLQNSFENERKQFEDSLEKSKEVGKMLAEEVMREKLKNET-----I 1101 Query: 183 KFEERVKQRDKRLE 224 K+EER+ + ++E Sbjct: 1102 KYEERINEMSSQME 1115 >SB_26137| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.27) Length = 271 Score = 33.1 bits (72), Expect = 0.17 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 1/92 (1%) Frame = +3 Query: 3 QKEQLQKEFGVQL-ANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVL 179 ++ Q++KE + A EKE ++ EKEA ER + A+ E + T+K E +T K ++ Sbjct: 170 KEAQMEKEAETEKEAQTEKEAQT-EKEA-EREKEAETEKEAKTEK-EAETEKEAQTEKEA 226 Query: 180 IKFEERVKQRDKRLEEAAAHETALRARSRPGT 275 +E KQ++ E+ A E + T Sbjct: 227 ETQKEAEKQKEAETEKEAETEKEAETEKKAET 258 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 33.1 bits (72), Expect = 0.17 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = +3 Query: 6 KEQLQKEFGVQLANIE-KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 K LQK+ +Q A + EMK +E L ADA K L +++E + E+ G Sbjct: 1284 KSALQKQ--LQSAQTQCAEMKKVVEERAAALEEADAVKKKLVREMEALNTTVEEIQGSNA 1341 Query: 183 KFEERVKQRDKRLEEAAAHETALRAR 260 K E K R + E A E A+ R Sbjct: 1342 KLE---KTRKRLQNEMMAEEKAISER 1364 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 33.1 bits (72), Expect = 0.17 Identities = 15/69 (21%), Positives = 37/69 (53%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEAA 233 +E++ +E + +AEN + ++LE+Q +K +L E+++++ K+L++ Sbjct: 1300 EELRKNIQELQAIRSRIEAENADVNRQLEEQENKGGQLGKAKKNLEQQLEELKKQLDDEM 1359 Query: 234 AHETALRAR 260 + +AR Sbjct: 1360 RAKAEAQAR 1368 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 32.7 bits (71), Expect = 0.22 Identities = 22/83 (26%), Positives = 37/83 (44%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 Q +QLQ E Q ANI + + + + +R + N+ L + E + + EL V Sbjct: 463 QHQQLQDELRQQEANIAENKRELARTTNKAMREQEVVNRLLEEIKELENFEEEELPDV-T 521 Query: 183 KFEERVKQRDKRLEEAAAHETAL 251 EE V +++ E +T L Sbjct: 522 TLEEEVVNITQQIAELKEQKTKL 544 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 32.7 bits (71), Expect = 0.22 Identities = 20/81 (24%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +KE+L++ + +E++ K +EKE +ER + + E + + ++ E+Q + + Sbjct: 300 KKEELKER--KRQEKLEQKAKKKEKERQEREKEKEREKERIQQEKEKQKERREKEKQKHQ 357 Query: 183 KFEERVKQRDK-RLEEAAAHE 242 + +E+ +QR+K +LE+ E Sbjct: 358 EKKEKERQREKEKLEKEKQKE 378 Score = 28.3 bits (60), Expect = 4.7 Identities = 19/67 (28%), Positives = 37/67 (55%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +KE+ +++ +Q EK+ + REKE ++ + E + +KLE++ K E L Sbjct: 328 EKEKEREKERIQQEK-EKQKERREKEKQKHQEKKEKERQREKEKLEKEKQKELE-RKELQ 385 Query: 183 KFEERVK 203 + +ER+K Sbjct: 386 RQKERMK 392 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 32.7 bits (71), Expect = 0.22 Identities = 19/72 (26%), Positives = 44/72 (61%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 ++EQ ++E +L ++EKE + R ++ EE+ R + E + KK+E++ + + A I Sbjct: 187 EREQKEREKQQKL-DMEKEERRRRQQEEEKKRREEEEKR---KKVEKEKQEREKAAKKNI 242 Query: 183 KFEERVKQRDKR 218 K +++ ++ D++ Sbjct: 243 KRQQQQQRTDQQ 254 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 32.7 bits (71), Expect = 0.22 Identities = 21/73 (28%), Positives = 37/73 (50%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 +KE+K +KE E+ + ++K T+K E++ K E K E R K++ K+ EE Sbjct: 130 DKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTKKEEK-ESREKEKTKK-EEK 187 Query: 231 AAHETALRARSRP 269 + E + + P Sbjct: 188 ESKEKDKQKKDPP 200 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 32.3 bits (70), Expect = 0.29 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 2/78 (2%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSRE--KEAEERLRNADAENKTLTKKLEQQTSKSSELAGVL 179 +E+L++ V+ IE E ++E E EE +RN D L +K++ S+ + Sbjct: 676 REELEQ---VRKDKIESEKVAQELRMELEEVVRNRDKIVGELREKMQHVVSEKERSEILN 732 Query: 180 IKFEERVKQRDKRLEEAA 233 K+++ V+++DK +EE A Sbjct: 733 DKYQKLVQEKDKLIEEQA 750 >SB_4371| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0027) Length = 674 Score = 32.3 bits (70), Expect = 0.29 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +3 Query: 57 EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 E+KS KE + RL + +N L + LE+ ELA L + V + +K L A Sbjct: 358 ELKSSVKEKDVRLDVMEQKNARLERDLEKSVDSKEELASELSSKKLEVSKLEKELRTA 415 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/74 (21%), Positives = 39/74 (52%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 K Q + E + ++ ++++++++ EE R +NK LT Q + + A +L Sbjct: 423 KVQKENEKSETILKLKADIQAKDEQIEELERQLKEQNKKLTTIKRNQQLEREKQAQLLND 482 Query: 186 FEERVKQRDKRLEE 227 +++ + D+R++E Sbjct: 483 VKKQGNEHDERVDE 496 >SB_833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 32.3 bits (70), Expect = 0.29 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 6/79 (7%) Frame = +3 Query: 9 EQLQKEFGVQLANIE---KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVL 179 E + E +L ++E KE++ +EKE ++L A LTK E+ K + Sbjct: 91 EDYEMEGDEKLLDLEAKLKEVERQEKETLDKLHEAQRREVVLTKDYERAVEKGDNFYAKI 150 Query: 180 IKFEERV---KQRDKRLEE 227 + +E+V Q+ K LEE Sbjct: 151 DELQEKVDDTTQKIKLLEE 169 >SB_25419| Best HMM Match : PH (HMM E-Value=2.8e-16) Length = 453 Score = 32.3 bits (70), Expect = 0.29 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 EQL++E IEKE + + E+ + + + + + L+Q + + L LI+ Sbjct: 38 EQLEQERKAMQEIIEKEREEERLKLEKEHQRMEEQQRQQQEALKQAEEERARLREQLIR- 96 Query: 189 EERVKQRDK-RLEEAAAHETALRARSRPG 272 E V QR+K RL + +R++S G Sbjct: 97 EREVMQREKSRLMKLQQDYKQIRSKSPEG 125 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 31.9 bits (69), Expect = 0.38 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 3/83 (3%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLR---NADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQ 206 ++A +EKE+K + K AE+ ++ N + E L + L+ Q E L + + ++ Sbjct: 643 RVAELEKELKEKTKSAEKLVKASENREKEIDALKRALQDQDQVMEEQQDALTERQLEIES 702 Query: 207 RDKRLEEAAAHETALRARSRPGT 275 + L T+ + R GT Sbjct: 703 LTEELRTLTDQNTSTYSLRREGT 725 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 31.9 bits (69), Expect = 0.38 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +3 Query: 15 LQKEFGVQLANIEKEMKSREKEAEERLRNADAEN-KTLTKKLEQQTSKSSELAGVLIKFE 191 ++KE+ +A + +EMK + K + L N + K + + + K S L+ +F+ Sbjct: 476 IEKEYQTTIAQLREEMKLKWKSERKSLFNKNKNKVKQYEENITELEMKVSRLSTENARFQ 535 Query: 192 ERVKQRDKRLEEAAAHETALRAR 260 E + K++E ++L R Sbjct: 536 ENLSASTKQIEHWKTKHSSLLER 558 >SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) Length = 714 Score = 31.5 bits (68), Expect = 0.51 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 4/78 (5%) Frame = +3 Query: 48 IEKEMKSREKEAEERL---RNADAENKTLTKKLEQQTSKSSELAGVLIKF-EERVKQRDK 215 ++K+ K EKE +ER R A AE + + Q+ K + L+K EE+ Q+ K Sbjct: 137 VKKQKKRLEKEGDERKRKEREARAEKERELEMERQRIKKKEQDLNRLMKIVEEKSNQQKK 196 Query: 216 RLEEAAAHETALRARSRP 269 +L + A ++ + + P Sbjct: 197 QLSQLAPAPISITSSNTP 214 >SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 31.1 bits (67), Expect = 0.67 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 63 KSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLE 224 + R ++AEE+ ++ DAE L +KLEQ E K + + + K LE Sbjct: 516 EERRQKAEEQKKSMDAEIHELKRKLEQSEESLKESDAKFTKTNDELDKVKKALE 569 Score = 29.1 bits (62), Expect = 2.7 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 4/90 (4%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKS----SELAGV 176 ++L KE A +E E + +E ++ E L K+E + K+ E A Sbjct: 429 QKLMKETEELKAKMEDEHQKALGLKDEDIQKLMKETDELKAKMEDEHQKALGLKDEDAQR 488 Query: 177 LIKFEERVKQRDKRLEEAAAHETALRARSR 266 LIK E +K + +EEA E A+ R Sbjct: 489 LIKETEELKAKMAEIEEARKGEVAMAEEER 518 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 31.1 bits (67), Expect = 0.67 Identities = 22/81 (27%), Positives = 37/81 (45%) Frame = +3 Query: 24 EFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVK 203 E +++ +E K+ K EER + ENK L K E++ L + FE++ Sbjct: 801 ELEQEISKFRQENKALAKIREER----EQENKALAKIREEREQGLIRLQDEITSFEKQKS 856 Query: 204 QRDKRLEEAAAHETALRARSR 266 + +RLE+ ET R + Sbjct: 857 EELERLEKFREEETQKLRREK 877 >SB_7313| Best HMM Match : IQ (HMM E-Value=0.00059) Length = 104 Score = 31.1 bits (67), Expect = 0.67 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEM--KSREKEAEERLRNADAENKTLTKKLE 140 E+LQKE +++ +E+E K R+KE EER R + E K + LE Sbjct: 44 EKLQKEAWLKIVQMEREQAEKERQKEEEERKRRKE-EAKRRARILE 88 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 31.1 bits (67), Expect = 0.67 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSEL 167 E+ KE ++ N+E+E S A E+ +T+ KK+++ T ++SEL Sbjct: 697 ERRSKEAEKRIENLEQECASANDMAMEKSVELSRLKRTIEKKIDKLTKENSEL 749 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/75 (20%), Positives = 37/75 (49%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 ++E+L++ + I++ + K+ + LR + + +K ++ + L Sbjct: 176 EEEELERRKHQERMEIQRREAEKVKQMMDELRKKEERRRKREEKRRKKKEEQERLEQQRR 235 Query: 183 KFEERVKQRDKRLEE 227 + E+R+ ++ KRLEE Sbjct: 236 QREQRIAEKRKRLEE 250 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENK 119 EQ +KE +L KEMK R++E E L +NK Sbjct: 317 EQQEKELRDKLLKNLKEMKERKQELERELLRKQIKNK 353 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 30.7 bits (66), Expect = 0.88 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK-FEERVKQRDKRLEE 227 K+++ ++KE E+RLR + + +K+ QQ K ++ K +E++++++K L E Sbjct: 955 KQLQLQQKEEEDRLRKKIMKEQRELEKMLQQKEKERQVERQKQKQLQEQLQEQEKALRE 1013 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 30.7 bits (66), Expect = 0.88 Identities = 20/71 (28%), Positives = 36/71 (50%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 EKE K + ++ EE+ + + E + T+K E +T K +E +E+ K+ +K E+ Sbjct: 36 EKETKKKTEKEEEKWKQEETEKEAETEK-EAETEKEAE--------KEKKKKTEKEEEKG 86 Query: 231 AAHETALRARS 263 ET A + Sbjct: 87 KQEETGKEAET 97 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 30.7 bits (66), Expect = 0.88 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSE-LAGVLI 182 KE+ KE+ L + E +++ E+ A E + + KKL++Q +++ + L Sbjct: 4477 KEKHYKEYADCLNQLTPEQAEEHRKSVEKAMAAARELEEVKKKLDEQRAENEDKLRQQNQ 4536 Query: 183 KFEERVKQRDKRLEEAAAHETAL 251 +FEE +QR + EE A E L Sbjct: 4537 EFEE--EQRRRLEEEMGAFEKQL 4557 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 30.7 bits (66), Expect = 0.88 Identities = 16/62 (25%), Positives = 34/62 (54%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK 215 +L N +E + KE EE+L+ + E + L KK+ + + K ++ K E ++ +++K Sbjct: 615 ELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSDKLKDMETSRNKVETKLAEQEK 674 Query: 216 RL 221 + Sbjct: 675 TI 676 >SB_36409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/74 (22%), Positives = 40/74 (54%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 K+ + ++L ++++++K +EK+ +E L+ + K LTK+LE + + L Sbjct: 92 KDAEVSDLKIKLDDLQQKLK-QEKQIQEDLQGHSRQVKMLTKELEILRAHEEKTRSELQS 150 Query: 186 FEERVKQRDKRLEE 227 E + +K+L++ Sbjct: 151 TEGNASELEKKLKQ 164 >SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/62 (27%), Positives = 34/62 (54%) Frame = +3 Query: 42 ANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRL 221 AN +K + + + + N+D+ KT+T KL + T++ SEL + E ++++ +R Sbjct: 297 ANCKKLEQQLAEAVDSKSINSDSM-KTITAKLTEATNRVSELQNMFTSMETQLQKSQERQ 355 Query: 222 EE 227 E Sbjct: 356 VE 357 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 51 EKEMKSRE-KEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK 215 EKE K RE +E EER R + + +K E++ K E + EER KQR++ Sbjct: 432 EKERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEER-KQREE 486 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEAA 233 +E + R +E EER + + + +K ++ K E + EE KQ++K E+ Sbjct: 441 EEEEERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEEKKR 500 Query: 234 AHE 242 E Sbjct: 501 KEE 503 Score = 27.5 bits (58), Expect = 8.2 Identities = 22/92 (23%), Positives = 38/92 (41%), Gaps = 3/92 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENK---TLTKKLEQQTSKSSELAG 173 Q+E+ +K+ + +E + ++KE EE + + E K KK E+ S Sbjct: 468 QREEEEKKREEEERKQREEEERKQKEKEEEKKRKEEERKHKEEEEKKTEESYDDSWRGRR 527 Query: 174 VLIKFEERVKQRDKRLEEAAAHETALRARSRP 269 K EE K+R++R H + P Sbjct: 528 ARRKAEEERKERERRERLEKKHSEPEKKTEEP 559 >SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) Length = 576 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/71 (21%), Positives = 36/71 (50%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 + E+ + + + +E+++K +++E EE R + + K + + K + G+ Sbjct: 262 EDEEFEDKLKARTLILERKIKEQDREREEMERESQNLEQAGLKDFKTKQEKRLKEIGLAE 321 Query: 183 KFEERVKQRDK 215 FEE ++RD+ Sbjct: 322 LFEEEQRKRDE 332 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 75 KEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA-AAHE 242 K+ E LRN + K+ KL ++ + EL GV+ + E +KQ + LE + +HE Sbjct: 84 KQLREGLRNPKVKEKSENTKLNKER-EILELKGVINQHEINIKQLQQELENSHQSHE 139 >SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) Length = 337 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAE---ERLRNADAENKTLTKKLEQQTSKSSELAG 173 ++E++++ F ++ + E E+K E+E + L+ AE K KKLE++ E Sbjct: 249 KEEKMRQRFVQKVKDKENELKKAEQELHAKFDHLKKVQAEEK---KKLEEKRKMLEEEMS 305 Query: 174 VLIKFEERVKQRDKRLEEAAAH 239 + K + + ++A AH Sbjct: 306 LFEKQKAAANTAQAQAQQATAH 327 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.3 bits (65), Expect = 1.2 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENK--TLTKKLEQQTSKSSELAGV 176 Q+E L K+F Q +E EM++ +E E L + + + L + E Q + + Sbjct: 259 QREALDKQFKEQREALEAEMQTAIQEHEAMLMRQEIQRRQEELQRFEEMQHREEMMRQEM 318 Query: 177 LIKFEERVKQRDK--RLEEAAAHETA 248 L + E +++RD+ R+EE E A Sbjct: 319 LQQQEMEMRRRDEEMRMEEMRRREEA 344 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 29.9 bits (64), Expect = 1.5 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSRE-KEAEERLRN--ADAENKTLTKKLEQQTSKSSELAG 173 Q+ +L K + IEKEM++++ +EA R + A A+ + KK + + K + Sbjct: 654 QQRRLAKMRRQEQLRIEKEMRAQQAQEARRRKKEDVASAKYEEAMKKAKDRELKRQQ--A 711 Query: 174 VLIKFEERVKQRDKRL 221 +L+K +ER ++R +++ Sbjct: 712 ILLKQQEREQKRQQQM 727 >SB_41574| Best HMM Match : DUF164 (HMM E-Value=0.47) Length = 361 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/84 (23%), Positives = 46/84 (54%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 E L+KE +Q++ K++ ++ +E+ RN++A K+L + ++ T +LA + Sbjct: 20 ELLEKEKELQVSLSGKQISQLKQHLDEQRRNSEAIQKSLVAERKEVTGLKLKLA----ES 75 Query: 189 EERVKQRDKRLEEAAAHETALRAR 260 E +K+ + +L +++ L A+ Sbjct: 76 ENELKRVNDKLCSSSSEAKKLSAK 99 >SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) Length = 649 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/76 (21%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELA----GVLIKFEERVKQRDKR 218 +++MK + + EE+++ ++ ++K + K E++ S ++ L +E+++ QRD Sbjct: 446 QEQMKLKLRNEEEKMKVSEMKDKVVQKTQEEKLSIRQQITEKHLRALENYEQQLMQRDNE 505 Query: 219 LEEAAAHETALRARSR 266 L + + +R R Sbjct: 506 LRSSKRKKLEKVSRQR 521 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELA 170 + EQL+K+ Q +E+ ++++ E +L +EN L +++ KSS LA Sbjct: 2076 EHEQLRKKLQSQAEKEMEEVLNQKRIVERKLAEEQSENDELHRQMAGLKKKSSRLA 2131 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/82 (29%), Positives = 46/82 (56%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 Q+E+L ++ G Q+ +E + K R + A ER + + ++K+LE +K EL V Sbjct: 2250 QEEELDEQAG-QIQILE-QTKLRLEMAGER------DKQLISKELE---AKEEELEEVRY 2298 Query: 183 KFEERVKQRDKRLEEAAAHETA 248 ++++KQ + +LEE +T+ Sbjct: 2299 SMQKKIKQLEAQLEEEYQEKTS 2320 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 29.9 bits (64), Expect = 1.5 Identities = 24/85 (28%), Positives = 38/85 (44%) Frame = +3 Query: 18 QKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEER 197 ++E +Q A EKE RE EAE + + ++ EQ+ E I+ EER Sbjct: 338 KEEERMQNAMEEKERHDRE-EAERLAEEQRMKEEERKEREEQERIAREEAEKKAIEDEER 396 Query: 198 VKQRDKRLEEAAAHETALRARSRPG 272 KQ + +E + +R+R G Sbjct: 397 RKQEEIERQERRRRVEQIMSRTRHG 421 >SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 29.9 bits (64), Expect = 1.5 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 10/90 (11%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENK----TLTKKLE------QQTS 152 Q EQ E ++++ + K + + AE+ + EN+ TLT +LE QQ Sbjct: 167 QNEQKISELNIEISELSKNFQEAKLLAEKTIEELKRENEERVQTLTSELESTILIKQQQE 226 Query: 153 KSSELAGVLIKFEERVKQRDKRLEEAAAHE 242 K+ A L+K E Q E HE Sbjct: 227 KARLAAEQLVKQEREDHQNKLSDENQRRHE 256 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 E +K+REK ++R++ + L K+ EQ + + + +ER KQR+K+ +E Sbjct: 121 EAALKAREKREKDRIKYIKKQESDL-KRREQWQKEMKQKKDEQV--DEREKQREKQRQEK 177 Query: 231 AAHETALR 254 E R Sbjct: 178 IMREQMSR 185 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 9/72 (12%) Frame = +3 Query: 54 KEMKSREKEAEER-------LRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRD 212 +++K+ KEAEER L E L K+E+ T KS L G K ++ K+ + Sbjct: 1294 EKIKASLKEAEERFQELNRTLEEVQKEKNALESKIEELTQKSETLMG---KHSDKEKELE 1350 Query: 213 KRLEEAA--AHE 242 K E+ +HE Sbjct: 1351 KATTESVKFSHE 1362 >SB_44017| Best HMM Match : SKIP_SNW (HMM E-Value=0) Length = 754 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +3 Query: 42 ANIEKEMKSREKEAEE-RLRNADAENKTLTKKLEQQTSKS-SELAGVLIKFE-ERVKQRD 212 A +EK++ +EKE +E +LR + + ++ +S E +++E + ++RD Sbjct: 529 AQLEKKVAQKEKEKQEKKLRELATKTREERAGIKAAVDRSEEEQERDQLRYERHKERERD 588 Query: 213 KRLEEAAAHETALRARSR 266 +R+ +AA + + AR + Sbjct: 589 RRISKAAPDKRSKLARDK 606 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/55 (25%), Positives = 29/55 (52%) Frame = +3 Query: 54 KEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKR 218 K++K + EE LR ++ +++ LT ++++ E A E+R+ +KR Sbjct: 2329 KDLKEKVTSLEEELRLSNKQSERLTSQVQRLERDLDEAAAQKSDMEDRIATLEKR 2383 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/75 (28%), Positives = 38/75 (50%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 QKE FG ++A E + +A+ +L DA L KLE++ ++ + L Sbjct: 944 QKEDELVLFGDKVAAKENDYS----QAQHQLVLKDASISALNDKLEERNAQLEKATKSLQ 999 Query: 183 KFEERVKQRDKRLEE 227 + ++R ++ D RLE+ Sbjct: 1000 QRKKRAEELDSRLEQ 1014 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 10/90 (11%) Frame = +3 Query: 3 QKEQLQKEFGV---QLANIEKEMKSREKEAEERLRNADAENKTLTKK---LEQQTSKSS- 161 +KE+ +K+ QL+ +E E+ K E+ + + L+ + LE+ TS Sbjct: 1191 EKEEFEKKLSSLLEQLSEMESEVSVLNKSCTEKTGEVEHLKRQLSNRDEELEEMTSVKER 1250 Query: 162 ---ELAGVLIKFEERVKQRDKRLEEAAAHE 242 EL + + RVK+ ++ +EE AHE Sbjct: 1251 IVDELTNLFTDRDTRVKELEQMIEE-RAHE 1279 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +3 Query: 48 IEKEMKSREK-EAE-ERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRL 221 +EK +R++ +AE E L+N+ E K L + EQ+ + S+ G ++ + + RL Sbjct: 552 LEKAKAARKRHQAEIEELKNSLEEVKQLAAQYEQEVAAESQ--GEDLELMDSQLEEYNRL 609 Query: 222 EEAAAHETA 248 +E A ETA Sbjct: 610 KEEARRETA 618 >SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) Length = 1001 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 4/82 (4%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLRNADAENK---TLTKKLEQQTSKSSELAGVLIK-FEERVK 203 QL+N +MK + +++++ A+NK + K Q K S + + IK E + Sbjct: 755 QLSNEVSDMKKTKARLMKQMKDEVAKNKQRESARNKEIAQLKKVSRMREIAIKNLESEKR 814 Query: 204 QRDKRLEEAAAHETALRARSRP 269 Q+D L ALR + +P Sbjct: 815 QKDIILRRKQEEVKALRRQQKP 836 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 29.1 bits (62), Expect = 2.7 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 5/89 (5%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRN--ADAENKTLTKK---LEQQTSKSSEL 167 +K + ++E + A+ E E R++E EERL+N D E K L ++ L ++ K E Sbjct: 203 EKRKAEEEEARRKAD-ELEKIKRQQEDEERLKNQRLDEERKKLEEEEANLMEEERKRKEE 261 Query: 168 AGVLIKFEERVKQRDKRLEEAAAHETALR 254 A + EER ++ ++ + E LR Sbjct: 262 AEKKREEEERKRREEEEAAQKWKKEELLR 290 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/72 (22%), Positives = 40/72 (55%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 ++ +K+ + AN+ +E + R++EAE++ R + + ++ Q+ K L ++ Sbjct: 238 DEERKKLEEEEANLMEEERKRKEEAEKK-REEEERKRREEEEAAQKWKKEELLRQQQLER 296 Query: 189 EERVKQRDKRLE 224 E+ ++R +RL+ Sbjct: 297 EKEEQERAERLQ 308 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +3 Query: 36 QLANIEK-EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRD 212 +L + EK ++ EKE +++ D E K L K+ ++ + + K E+ K+R+ Sbjct: 522 KLTHEEKLKLAEEEKEKKKQQIQEDKEKKKLQKEKDRAVEREKREKERVQKKLEKDKERE 581 Query: 213 KRLEEAAAHETALRARSRP 269 ++ E+ R SRP Sbjct: 582 RQREQKRKEALWYREWSRP 600 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/65 (27%), Positives = 34/65 (52%) Frame = +3 Query: 48 IEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEE 227 +E E+K R + E+ L+N EN+ L + L++ + ++ L + E QR + +E Sbjct: 288 LEMELKGRLMDREKGLQNQSMENRKLAQSLDELRQQLRDMKNKL-SYAENEAQRLR--DE 344 Query: 228 AAAHE 242 AA + Sbjct: 345 IAARD 349 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 E+L KE L + K M +KE E+ + E K KKL+++ K E ++ Sbjct: 206 ERLAKEVTKTLEELRKTM---QKELEDAKVKLEQEKKDSVKKLKERLEKERESEEERLQK 262 Query: 189 EERVKQR---DKRLEEAAAHETALR 254 E R DK E+ E L+ Sbjct: 263 EHDAVMRTLGDKAREDTLEEEAMLQ 287 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 6/80 (7%) Frame = +3 Query: 15 LQKEFGVQLANIEKEMKSREKEAEERLRNADAEN--KTLTK---KLEQQT-SKSSELAGV 176 L+K +L K + SR K A+ R + EN K L K +LE+Q + +L Sbjct: 197 LRKNARRELNRRRKMLTSRVKTAQRRRKRRSDENLSKQLEKARSELEKQKLHEGQKLEEA 256 Query: 177 LIKFEERVKQRDKRLEEAAA 236 +FE+++++ ++LEE A Sbjct: 257 RHEFEKQIQEEGRQLEEMRA 276 >SB_27802| Best HMM Match : Filament (HMM E-Value=0.2) Length = 528 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +3 Query: 45 NIEKEMKSREKEAEE---RLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK 215 N+ K ++ +KE + L+NA + L L+ + K EL G+L ERVK + Sbjct: 56 NLTKLLEDAQKEVSKLKSSLKNAGSCIDGLQGNLKTEKEKGKELEGMLQSANERVKDMED 115 Query: 216 RLEE 227 + + Sbjct: 116 EIAQ 119 >SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTK 131 + EQLQK F + +EK+ +S+ E EE L+ +E + L+K Sbjct: 789 EMEQLQKNFVKEREEMEKDYQSQINELEESLK---SEKEVLSK 828 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 105 DAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRD 212 DAE + K++E+ K EL+ + + E +K+RD Sbjct: 712 DAERENHRKEIERLEGKVQELSDAISEHEGSIKERD 747 >SB_45719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 3.6 Identities = 22/76 (28%), Positives = 39/76 (51%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK 215 +L+ E+K ++ EE D E+K ++LE T++ ++A K + ++Q D Sbjct: 157 ELSEYLDELKMLQETNEELEMKLD-ESK---RELEAATTEMDKIADEYTKLKTILQQSDL 212 Query: 216 RLEEAAAHETALRARS 263 LEE ALRA++ Sbjct: 213 ILEEMRRERDALRAQA 228 >SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) Length = 1500 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +2 Query: 257 EIEARDLTIKQLEKTVLERENRLYQVTTQLDEMKRVQEMVAKLMSKSTSA 406 E AR++ + E+ ++ERE + + T+L+E+K +E V S+S A Sbjct: 979 EYYARNVNV-DFEELLMEREQEVDSLRTKLNELKLREESVGPNYSRSDMA 1027 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 39 LANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK-FEERVKQRDK 215 L N+ + +++RE+E A+ K K+L T++ + K FEE +K + K Sbjct: 136 LQNLTRTLENREREL--------ADLKEFVKELTHNTTQPDPEQSIRSKGFEEELKAKQK 187 Query: 216 RLEEAAAHETAL 251 +EE + T + Sbjct: 188 LIEELLSERTRM 199 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 57 EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSEL-AGVLIKFEERVKQR 209 EMK + + E L++++ EN+ + K L QQ K ++L G+ E+V R Sbjct: 1899 EMKRKNADYELALQSSNLENEEMQKDLVQQQMKITDLEEGMQRMLREQVNLR 1950 >SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) Length = 408 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 FK Y + + YCP +N+L+Y Sbjct: 90 FKSYLNALSYCPYKSYLNVLLY 111 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 162 YKSYLNVLSYCPYKSYLNVLSY 183 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 198 YKSYLNVLSYCPYKSYLNVLSY 219 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 246 YKSYLNVLSYCPYKSYLNVLSY 267 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 270 YKSYLNVLSYCPYKSYLNVLSY 291 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 282 YKSYLNVLSYCPYKSYLNVLSY 303 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 318 YKSYLNVLSYCPYKSYLNVLSY 339 >SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) Length = 392 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 FK Y + + YCP +N+L+Y Sbjct: 74 FKSYLNALSYCPYKSYLNVLLY 95 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 146 YKSYLNVLSYCPYKSYLNVLSY 167 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 182 YKSYLNVLSYCPYKSYLNVLSY 203 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 218 YKSYLNVLSYCPYKSYLNVLSY 239 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 230 YKSYLNVLSYCPYKSYLNVLSY 251 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 254 YKSYLNVLSYCPYKSYLNVLSY 275 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 562 FKIYCHIIKYCPISQNINILIY 497 +K Y +++ YCP +N+L Y Sbjct: 302 YKSYLNVLSYCPYKSYLNVLSY 323 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 28.7 bits (61), Expect = 3.6 Identities = 19/88 (21%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEA---EERLRNADAENKTLTKKLEQQTSKSSELAGV 176 K +L+ G +L N++ E+ K+ E+ +++ ++ENKTL ++ + + + V Sbjct: 2980 KARLEAADG-KLMNLQDELHKTSKDRVIDEKTIKDKESENKTLKEEEQDLKRRLRQADNV 3038 Query: 177 LIKFEERVKQRDKRLEEAAAHETALRAR 260 + + ++ K EE L+ R Sbjct: 3039 QLNLRKDLEDLQKEKEELRKENENLKKR 3066 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 28.3 bits (60), Expect = 4.7 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 36 QLANIEKEMKSREKEA-EERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRD 212 Q+ N+E+E++S++ EA EER R A ++ EQ ++ ++ + E + Q Sbjct: 1539 QVRNLEEEIESKDAEAEEERTRIVKAAEGFALEREEQFKAELADKDDCIQATENELNQVK 1598 Query: 213 KRLEEA-AAHETALRA 257 +L+ A A +T L A Sbjct: 1599 HQLQLAQEAKKTLLEA 1614 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/82 (19%), Positives = 40/82 (48%) Frame = +3 Query: 21 KEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERV 200 +E + N+E E+K+ EK+ +L N +++ ++++++ +L + E V Sbjct: 191 RELKQKKQNLELELKNAEKKGSRQLENMLKDHEEEVRRMKEE---RKDLCEEIKALREEV 247 Query: 201 KQRDKRLEEAAAHETALRARSR 266 + R+ + E +L R++ Sbjct: 248 NEFKARVSHLKSEERSLDRRTK 269 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 9/80 (11%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTL----TKKLEQQTSKSSELA 170 ++ +L+ E+ ++ I +EM + +K E+RL++ + + K +E T K E Sbjct: 136 REAKLRNEYSEKMLAISREMLTSKKHFEDRLKDFQSMRRKFEEDRDKAVESLTGKHHEEL 195 Query: 171 GVLIK-----FEERVKQRDK 215 L+K ++E VK++ K Sbjct: 196 DQLMKAHRVRYDEVVKEKQK 215 >SB_9049| Best HMM Match : SMC_C (HMM E-Value=0.0098) Length = 661 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +3 Query: 6 KEQLQKEFGVQL-ANIEKEMKSREKEAEERLRNADAENKTLTKKLEQ 143 +EQ + E Q N+ KE +SR+KE + DA+ L K +Q Sbjct: 511 EEQARAECNYQTDPNVIKEYESRDKEIKSMSGQIDAQESNLAAKQQQ 557 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/77 (25%), Positives = 41/77 (53%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +KE+ + E ++E + +EKE +ER+ + E K ++ ++ +K +E+ Sbjct: 749 RKERKKIEMEEAKKREQEEKERKEKEEKERIEREEREAK--EREYAERIAKQNEIDR--- 803 Query: 183 KFEERVKQRDKRLEEAA 233 K E+ + ++RLEE A Sbjct: 804 KRREKELEIERRLEERA 820 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.3 bits (60), Expect = 4.7 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +K L+K+ ++ ++EKE EK+ + + LTKK E + S L Sbjct: 168 KKLGLEKKKTSEIEDLEKERNEAEKKYNSLRKEKENLVSELTKKFEMLEGQKSSLVEENK 227 Query: 183 KFEERVKQRDKRLEEA 230 ++ VK RL+++ Sbjct: 228 VLQDSVKDLKIRLKKS 243 >SB_37125| Best HMM Match : DUF1542 (HMM E-Value=0.76) Length = 580 Score = 28.3 bits (60), Expect = 4.7 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +3 Query: 21 KEFGVQLANIEKEMKSREKEAEERLRNADAE-NKTLTKKLEQQTSKSSELAGVLIKFEER 197 K+F +Q+ I E+K E EE+ N + + N K E + + + AG K +E+ Sbjct: 229 KDFCIQVKVIISELKKAFGEDEEKEENDEEQANDESNVKGEAREERGGQ-AGKESKGKEK 287 Query: 198 VKQRDKRLEEAAAHE 242 K+++K E+ E Sbjct: 288 GKEKEKEKEKGKEKE 302 >SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +3 Query: 12 QLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELA 170 Q QKE QLA KE++ RE A+E + ++ K L++ E+Q ELA Sbjct: 211 QQQKEKDTQLAQRNKELQ-RELNAKEEI--LASKTKELSRACEKQFRLEQELA 260 >SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) Length = 503 Score = 28.3 bits (60), Expect = 4.7 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 6/83 (7%) Frame = +3 Query: 24 EFG---VQLANIEKEMKSREKE---AEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 EFG V+LA + S + E +R+ D+EN +L KLE++ SK ++ Sbjct: 193 EFGQLKVELAQSLEAHSSSQSEHLTLAQRVAQLDSENDSLKSKLEEERSKRESAEEKIVG 252 Query: 186 FEERVKQRDKRLEEAAAHETALR 254 + +R +L E H+ + R Sbjct: 253 LTAELDKRG-QLVENLEHQISQR 274 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/72 (23%), Positives = 39/72 (54%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK 215 +L + E + E++ ++ ++ A++E+ T L + S ++ + +ER+K+R+ Sbjct: 1672 ELRHCLTEKDNAEQKLKKTIQQANSEHILHTANLMESESFERKMN----ELDERIKERNA 1727 Query: 216 RLEEAAAHETAL 251 EE +AH+ L Sbjct: 1728 VAEELSAHKAEL 1739 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +2 Query: 269 RDLTIKQLEKTVLERENRLYQVTTQLDEMKRVQEMVAKLMSK 394 +D + L++ + +++NRL Q+T + +EM R + ++ K Sbjct: 1192 KDRELNNLKRDLEKKDNRLEQLTMESEEMHRSASSLKAIVDK 1233 >SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) Length = 1211 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 84 EERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEE 227 E + + E L KL +TSK+SEL G + K + +K+ + E Sbjct: 54 ESTIESLRGEVTVLEDKLHNETSKNSELEGKVEKQRQDIKRIKREKSE 101 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/74 (24%), Positives = 38/74 (51%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 +EQ Q QLA +K+ ++ +E E +L+ + + +L+QQ ++ E A L Sbjct: 963 QEQAQATPQQQLATQDKQQATQGQEQETQLQQQATQVQQQATQLQQQANQQQEQATQL-- 1020 Query: 186 FEERVKQRDKRLEE 227 ++ + Q+ + +E Sbjct: 1021 QQQAISQQQQAAQE 1034 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 27.9 bits (59), Expect = 6.2 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +3 Query: 6 KEQLQK--EFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVL 179 +E L K E +++ K++ K ++ L A AE TK + ++ E+ G+L Sbjct: 463 QEDLHKLQERNETISSENKQLYQLNKSLQDELNVASAER---TKLGSEVSALHGEVNGLL 519 Query: 180 IKFEERVKQRDKRLEE 227 + + QRDK +EE Sbjct: 520 SEKNSIIAQRDKAMEE 535 >SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/38 (23%), Positives = 24/38 (63%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENK 119 ++Q++++ +AN KEM+ K E++++ + E++ Sbjct: 1341 RKQIEEDLRASMANSAKEMEDMNKNWEDKVKESQLESR 1378 >SB_11059| Best HMM Match : KID (HMM E-Value=0.046) Length = 296 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/79 (21%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Frame = +3 Query: 36 QLANIEKEMKSREKEAEERLRNADAENK---TLTKKLEQQTSKSSELAGVLIKFEERVKQ 206 ++A +EKE+K + K AE+ ++ ++ K L + L+ Q E L + + ++ Sbjct: 107 RVAELEKELKEKTKSAEKLVKASEKREKEIDALKRALQDQDQVMEEQQDALTERQLEIES 166 Query: 207 RDKRLEEAAAHETALRARS 263 + L T+ + S Sbjct: 167 LTEELRTLTDQNTSTNSLS 185 >SB_8287| Best HMM Match : UVR (HMM E-Value=0.07) Length = 187 Score = 27.9 bits (59), Expect = 6.2 Identities = 20/67 (29%), Positives = 32/67 (47%) Frame = +3 Query: 24 EFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVK 203 E L+ E EMK+ E+ + L A + KTL K Q +S E L +++ Sbjct: 73 ELQSMLSKKESEMKAMEERYKRYLEKAKSVIKTLDPK--QNAGQSQEAVATL---RNQMQ 127 Query: 204 QRDKRLE 224 ++DK +E Sbjct: 128 EKDKLIE 134 >SB_36| Best HMM Match : E-MAP-115 (HMM E-Value=0.39) Length = 383 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/61 (29%), Positives = 34/61 (55%) Frame = +3 Query: 18 QKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEER 197 ++ F QLA E++ + R ++ EER+ A K +KLE++ + + LA KF ++ Sbjct: 88 RQRFQQQLAEAERQEQERRRKEEERI----AREKEQLRKLEEE-AVTKRLALFDYKFGDK 142 Query: 198 V 200 + Sbjct: 143 I 143 >SB_50165| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.1) Length = 176 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/79 (22%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +3 Query: 72 EKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEE-RVKQRDKRLEEAAAHETA 248 EKE + + E ++ ++ + ++ + AG L+ EE RV++R E + E Sbjct: 43 EKEPKRGEEQNNEEERSRRPRVLTEEQRARKRAGDLVLTEEQRVRKRQTSSENRLSGEQT 102 Query: 249 LRARSRPGT*PLSSWRRPC 305 +R + + L+ +R C Sbjct: 103 VRKKQKDSEYELNDEQRAC 121 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +3 Query: 84 EERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEAAAHETALRA 257 ++ L A+ EN +LE K EL L + ++ +KR EE + + LRA Sbjct: 2245 KDELLQAEKENDDAKAELESLKRKFLELGEELAHSGKYREELEKRFEELVSEKNVLRA 2302 >SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -3 Query: 153 YSFVVPVSSSASCSLRQRFSISPRLPSHVISSLFLCWRVEPRI 25 YS VVP + R S P P + + CW EP + Sbjct: 297 YSAVVPNELLSMLMSGFRLSRPPLCPEEIYDVMMSCWNAEPEV 339 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 27.9 bits (59), Expect = 6.2 Identities = 20/77 (25%), Positives = 37/77 (48%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 +K +++ V L ++ ++ K +E N E +L K LEQ+++ A Sbjct: 595 KKTPRKEKTKVVLTTTDENVRELVKLRQES-ENYARETTSLRKLLEQESAAKRFEAQCRR 653 Query: 183 KFEERVKQRDKRLEEAA 233 + EE+V +K +EE A Sbjct: 654 EVEEKVSDLEKEIEEVA 670 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 281 IKQLEKTVLERENRLYQVTTQLDEMKRVQEMV 376 + LEKTV RE+R+ + ++DE++R ++ + Sbjct: 295 VSSLEKTVEARESRIRTLECRVDELERQKKKI 326 >SB_14703| Best HMM Match : Borrelia_orfA (HMM E-Value=0.14) Length = 558 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/67 (17%), Positives = 35/67 (52%) Frame = +3 Query: 30 GVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQR 209 G + +EKE+K +E + + + + + +E++ ++++ + + E+ +K++ Sbjct: 211 GKSIDKLEKELKDQEAKHNRQKNTLEQTVAKMKEVMERKGGDANKVNARVAELEKELKEK 270 Query: 210 DKRLEEA 230 K E+A Sbjct: 271 TKSAEKA 277 >SB_13524| Best HMM Match : K_tetra (HMM E-Value=3.7e-18) Length = 495 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +3 Query: 45 NIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDK--- 215 +++++ +E E+ N +++ +TK +E+ +K E+ + +FEER K K Sbjct: 225 HVKEDQSLKEVAKEDEPLNQVTKDEFVTK-MEKLRAKKDEMLKKIEEFEEREKAAMKKIA 283 Query: 216 RLEEAAAHE 242 RLEE A + Sbjct: 284 RLEEVIAKD 292 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 257 EIEARDLTIKQLEKTVLERENRLYQVTTQLDEMKR 361 EIE+++ IK+L + VL +N L Q + DE+ + Sbjct: 923 EIESQEKEIKKLRRDVLSAQNSLDQSMQKRDELDK 957 Score = 27.5 bits (58), Expect = 8.2 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 8/82 (9%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEK---EMKSREKEAE-ERLRNADAENKTLTKKLEQQTSK----S 158 +K+ L K ++ EK E++ +AE E LRN +AEN+ LE+ +K Sbjct: 1904 RKDALDKGNTIEKLRAEKLQDEIEIENLKAELESLRNENAENEKEISHLEEDANKLGEDK 1963 Query: 159 SELAGVLIKFEERVKQRDKRLE 224 +EL +I+ + K + LE Sbjct: 1964 NELENKIIELTNQYKLKLAELE 1985 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 129 KKLEQQTSKSSELAGVLIKFEERVKQRDKRLE--EAAAHETALRARSRPG 272 +++++Q + E K +ER K+R++ E E ET +RAR R G Sbjct: 986 RRIQRQAELAKEEEEKKEKEQEREKERERLREQREKEREETRMRARDRSG 1035 >SB_32785| Best HMM Match : Spectrin (HMM E-Value=6e-06) Length = 441 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 87 ERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 ER + K +++E K + G+L+ + RVK+ +K LEE+ Sbjct: 162 ERWNKINKFYKNRRQQVELADEKVKKYRGLLLPLDTRVKKAEKSLEES 209 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.5 bits (58), Expect = 8.2 Identities = 22/72 (30%), Positives = 39/72 (54%) Frame = +3 Query: 9 EQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKF 188 E+L+K V A+I ++K R K+A + + N E KT+ LE+Q E +L Sbjct: 359 EELRKRPAVP-ADIVDQLK-RLKDAMDAI-NKWKEEKTIPADLEEQLKSLREGLALLDSH 415 Query: 189 EERVKQRDKRLE 224 E++K+ ++L+ Sbjct: 416 REQLKEMGEQLK 427 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/72 (20%), Positives = 36/72 (50%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 QK+++QKE + +K+ E++ EE+ E K ++ ++Q + + V Sbjct: 71 QKQEVQKEQKQEEQEEQKQEVQEEQKQEEQEEQKQEEQKQEVQEEQKQEEQEEQKQEVQE 130 Query: 183 KFEERVKQRDKR 218 + ++ V++ K+ Sbjct: 131 EQKQEVQEEQKQ 142 >SB_10419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +3 Query: 51 EKEMKSREKEA-EERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEE 227 + + K RE E E++ N ++ T+K E+ + SEL E ++++ K+ EE Sbjct: 440 DTDEKERELELLNEKISNLKVQHSVETRKREELEYELSELIRENQHLESQLREFAKQAEE 499 Query: 228 --AAAHETALRARS 263 AA E +L R+ Sbjct: 500 WRLAASEASLPERA 513 >SB_55906| Best HMM Match : SNARE (HMM E-Value=0.45) Length = 101 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 57 EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERV 200 E + RE E E+ + + KT++ +LE QT + + + + EE++ Sbjct: 32 EEEQRENEVEKVIDEQEQRMKTMSVQLESQTRQLEFMKSHMERIEEKL 79 >SB_50934| Best HMM Match : HSP90 (HMM E-Value=0) Length = 855 Score = 27.5 bits (58), Expect = 8.2 Identities = 24/98 (24%), Positives = 40/98 (40%), Gaps = 1/98 (1%) Frame = +3 Query: 6 KEQLQKEFGVQLAN-IEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLI 182 + L+ GV L +E E + E E EE+ DAE + KK E + + + V Sbjct: 725 ERMLRLSMGVDLEEKVEPEEEDEEAEKEEKEEEVDAEGEKEDKKGEDKPA-MEKAEDVDT 783 Query: 183 KFEERVKQRDKRLEEAAAHETALRARSRPGT*PLSSWR 296 K + + + + E+ R P PL+ +R Sbjct: 784 KTDSKPDPKSEGKEDEVEVSGRGRFLRIPSVSPLAGYR 821 >SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 27.5 bits (58), Expect = 8.2 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKE-AEERLRNADAENKTLTKKLEQQTSKSSEL---A 170 ++E++ K+ + N EKE ++EKE + + + E K + K+ E+ + L Sbjct: 487 ERERVNKK--KERLNKEKEQLNKEKEQLNKERKRLNKERKRVNKERERLNKEKERLNKET 544 Query: 171 GVLIKFEERVKQRDKRLEEAAAHETALRAR 260 L K ER+ + KRL + +R R Sbjct: 545 ERLDKTRERLNKERKRLNKKKERLNKVRKR 574 >SB_48386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 27.5 bits (58), Expect = 8.2 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +3 Query: 6 KEQLQKEFGVQLANIEKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIK 185 K LQ + A+++K +S + EE+ DA+ TLT+KLE + + ++E + Sbjct: 326 KLNLQSQLEGLTADMDKITESVSRTNEEK----DAQIATLTQKLEDERAAAAEEMRDKTR 381 Query: 186 FEERVK 203 F E+++ Sbjct: 382 FLEKLR 387 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 87 ERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERVKQRDKRLEEA 230 ER + K +++E K + G+L+ + RVK+ +K LEE+ Sbjct: 2190 ERWNKINEFYKNRRQQVELADEKVKKYRGLLLPLDTRVKKAEKSLEES 2237 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 487 LPRRPRACVRPPHPASSLRLFDVS 416 +P RP + PPHP + LFDV+ Sbjct: 679 VPARPPPPIPPPHPPALTILFDVN 702 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 3/94 (3%) Frame = +3 Query: 3 QKEQLQKEFGVQLANIEKEMKSREKEAEER---LRNADAENKTLTKKLEQQTSKSSELAG 173 ++EQ F ++ +++++ R K+ LR E K K ++ + + Sbjct: 854 EQEQEFMRFRLREGEKKEQLEERYKQLLNEYIALRKEVIEAKKAEKPDREKDEELNRKEA 913 Query: 174 VLIKFEERVKQRDKRLEEAAAHETALRARSRPGT 275 ++ K+ R K + LEE H+T + SR T Sbjct: 914 LIHKYMRREKGMQRMLEEQKKHDTVRHSTSRCDT 947 >SB_30796| Best HMM Match : SNARE (HMM E-Value=0.45) Length = 299 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 57 EMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVLIKFEERV 200 E + RE E E+ + + KT++ +LE QT + + + + EE++ Sbjct: 230 EEEQRENEVEKVIDEQEQRMKTMSVQLESQTRQLEFMKSHMERIEEKL 277 >SB_22059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = -3 Query: 528 RSHRTLTSSYT*YDCRDVPGPASVRLILLHL*GCSTSVAQFAEVLLLISLATISCTRFI 352 R H TL S + CR VP +S R +++ C +LL+ +A ++ TRF+ Sbjct: 110 RVHETLDSDHYTITCRPVPKTSSERALVI----CGFFATYLIPDVLLVIMA-VAVTRFL 163 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 3/74 (4%) Frame = +3 Query: 51 EKEMKSREKEAEERLRNADAENKTLTKKLEQQTSKSSELAGVL---IKFEERVKQRDKRL 221 EK+ K +EK +E ++ +TL KL +Q E+ VL K +E K+ K + Sbjct: 840 EKQEKEKEKIQKEEKEPEKSKVQTLLDKLHRQARVEEEVKLVLKVYFKHKEITKEEYKSI 899 Query: 222 EEAAAHETALRARS 263 A + A + S Sbjct: 900 LRRAVPQVANSSHS 913 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,998,247 Number of Sequences: 59808 Number of extensions: 183111 Number of successful extensions: 1296 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -