BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30946 (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 29 1.9 At4g17130.1 68417.m02579 hypothetical protein 29 2.5 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 29.5 bits (63), Expect = 1.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 556 CCYCYVMYKYSFFYFYNKTKC 618 C YCYV+Y+Y Y + KC Sbjct: 649 CPYCYVLYEYPIIYEESVLKC 669 >At4g17130.1 68417.m02579 hypothetical protein Length = 747 Score = 29.1 bits (62), Expect = 2.5 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 356 SSSKIVFPTTICLLVAVERLVNSHLPPRSAVSCHCIMA---WPKSIRFIVAIHST 511 SS I FP VA+ +V+S P S S CI+A P S+R VAI ST Sbjct: 612 SSCSIWFPEAPKGYVALSCVVSSGSTPPSLASTFCILASSVSPCSLRDCVAISST 666 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,958,904 Number of Sequences: 28952 Number of extensions: 192674 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -