BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30944 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 2.9 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 2.9 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 2.9 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 23 3.8 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.9 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 452 AYSVADGHSGDNKSQHESRTATLCTANTPCWKLT 553 AY++A G + D K + + L AN W LT Sbjct: 177 AYNIAMGDTADMKKTYNNIDYYLLAANYTGWYLT 210 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 452 AYSVADGHSGDNKSQHESRTATLCTANTPCWKLT 553 AY++A G + D K + + L AN W LT Sbjct: 177 AYNIAMGDTADMKKTYNNIDYYLLAANYTGWYLT 210 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 454 SEVVFRVSIFFFMVAGDKYFVGWSDH 377 ++VV + + FF + GD W++H Sbjct: 308 AKVVSKSGVLFFGLVGDSALGCWNEH 333 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 454 SEVVFRVSIFFFMVAGDKYFVGWSDH 377 ++VV + + FF + GD W++H Sbjct: 308 AKVVSKSGVLFFGLVGDSALGCWNEH 333 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 454 SEVVFRVSIFFFMVAGDKYFVGWSDH 377 ++VV + + FF + GD W++H Sbjct: 308 AKVVSKSGVLFFGLVGDSALGCWNEH 333 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/17 (52%), Positives = 11/17 (64%), Gaps = 2/17 (11%) Frame = +1 Query: 1 YQYVCQNCCF--KHCTS 45 YQY C NC + K+C S Sbjct: 43 YQYRCANCTYATKYCHS 59 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/51 (23%), Positives = 20/51 (39%) Frame = +2 Query: 386 PAHKVLVAGHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRTATLCTANTP 538 P H + GH +A P + +++ H H S A + +TP Sbjct: 414 PHHHTMGHGH-SHIHATPHHHHSHAATPHHQHSTPLAHSSYPAAIQIGHTP 463 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 410 GHHEEEYAHPKYDFAYSVADGHSG 481 G+ E ++P Y+F+ DG G Sbjct: 1045 GYRETSSSNPSYNFSSVSGDGEEG 1068 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 410 GHHEEEYAHPKYDFAYSVADGHSG 481 G+ E ++P Y+F+ DG G Sbjct: 1041 GYRETSSSNPSYNFSSVSGDGEEG 1064 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +1 Query: 493 SARVPHGDAVHGEYTLLEADGSVRKVEYTADDHHG 597 +AR+P+G+ + L D + + +DD G Sbjct: 666 TARLPNGEGTRADICQLLKDSQYIREQTESDDKEG 700 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 429 YSSSWWPATSTL 394 YS++ WPATS + Sbjct: 776 YSTTRWPATSVI 787 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -1 Query: 99 TAAADE*CGSGKRPAVATASTMLKATILANIL 4 +AAA + RPA +TA+T++ + +N++ Sbjct: 831 SAAATSSTSTSPRPASSTAATLVLSGCPSNMM 862 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,407 Number of Sequences: 438 Number of extensions: 2035 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -