BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30937 (599 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 26 0.28 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 2.0 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 25.8 bits (54), Expect = 0.28 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = -2 Query: 430 FVLAFSAFFLWMYSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLKTLCLCTQV 251 + L FS ++ + F +++ F SE + +++ YFR + KT CT V Sbjct: 353 YTLVFSVLKQYVMQQQVKNFRHSVRSVFFLSEIFGLVNLKYRETYFRLSKTKT--FCTLV 410 Query: 250 PSVAY 236 ++ Y Sbjct: 411 TALVY 415 Score = 25.0 bits (52), Expect = 0.49 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 271 LCLCTQVPSVAYAHWLYLFSYQ-SHSDDPFYVLLCFC 164 +C+ Q +A+ H LY+F ++ D FY+ C Sbjct: 618 ICVIVQSEQIAWLHLLYIFLVGIMYAADVFYICHVCC 654 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 114 ILDHLTDVLSGVGVCDLI 61 IL H+ SG+ +CDLI Sbjct: 252 ILWHIVGTFSGIFLCDLI 269 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,256 Number of Sequences: 336 Number of extensions: 3035 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -