BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30937 (599 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) simi... 126 1e-29 At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) simi... 124 6e-29 At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) simi... 123 1e-28 At4g16030.1 68417.m02432 60S ribosomal protein L19, putative sim... 46 3e-05 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 29 3.1 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 28 4.1 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 28 4.1 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 28 5.4 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 27 7.2 At3g06210.1 68416.m00714 expressed protein contains Prosite PS00... 27 7.2 At3g04340.1 68416.m00459 FtsH protease family protein similar to... 27 7.2 At2g32000.1 68415.m03910 DNA topoisomerase family protein simila... 27 7.2 At1g16370.1 68414.m01958 transporter-related low similarity to o... 27 7.2 At1g11880.1 68414.m01370 expressed protein contains Pfam profile... 27 7.2 At5g59500.1 68418.m07457 expressed protein 27 9.5 At1g23830.1 68414.m03006 expressed protein 27 9.5 >At3g16780.1 68416.m02142 60S ribosomal protein L19 (RPL19B) similar to ribosomal protein L19 GB:CAA45090 from [Homo sapiens] Length = 209 Score = 126 bits (304), Expect = 1e-29 Identities = 55/85 (64%), Positives = 68/85 (80%) Frame = +1 Query: 1 LAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEA 180 LAASVM+CGK KVWLDPNE +I+ NSRQNIRK++KDG +I+KP +HSR+R R EA Sbjct: 10 LAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEA 69 Query: 181 RRKGRHCGFGKRRGTANARMPQKEL 255 +RKGRH G+GKR+GT AR+P K L Sbjct: 70 KRKGRHSGYGKRKGTREARLPTKIL 94 Score = 82.2 bits (194), Expect = 2e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +3 Query: 306 AKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 446 +KKIDRH+YH +YMK KGNVFKNKRVLME IH+ KAEKAR K L+DQ Sbjct: 112 SKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLADQ 158 >At1g02780.1 68414.m00233 60S ribosomal protein L19 (RPL19A) similar to ribosomal protein L19 GI:36127 from [Homo sapiens] Length = 214 Score = 124 bits (298), Expect = 6e-29 Identities = 54/85 (63%), Positives = 68/85 (80%) Frame = +1 Query: 1 LAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEA 180 LAASVM+CGK KVWLDPNE ++I+ NSRQNIRK++KDG +I+KP +HSR+R RK A Sbjct: 10 LAASVMKCGKGKVWLDPNESSDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARKMKIA 69 Query: 181 RRKGRHCGFGKRRGTANARMPQKEL 255 + KGRH G+GKR+GT AR+P K L Sbjct: 70 KMKGRHSGYGKRKGTREARLPTKVL 94 Score = 81.0 bits (191), Expect = 6e-16 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 309 KKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 446 KKID+H+YH +YM+ KGNVFKNKRVLME IH+ KAEKAR K LSDQ Sbjct: 113 KKIDKHMYHDMYMRVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQ 158 >At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) similar to L19 from several species Length = 208 Score = 123 bits (296), Expect = 1e-28 Identities = 52/85 (61%), Positives = 70/85 (82%) Frame = +1 Query: 1 LAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEA 180 LA+SV++CGK+KVWLDPNE ++I+ NSRQNIRK++KDG +I+KP +HSR+R R+ A Sbjct: 10 LASSVLKCGKRKVWLDPNEGSDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARQLNIA 69 Query: 181 RRKGRHCGFGKRRGTANARMPQKEL 255 +RKGRH G+GKR+GT AR+P K L Sbjct: 70 KRKGRHSGYGKRKGTREARLPTKVL 94 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +3 Query: 309 KKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 446 KKIDRH+YH +YMK KGNVFKNKRVLME IH+ KAEKAR K LSDQ Sbjct: 113 KKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQ 158 >At4g16030.1 68417.m02432 60S ribosomal protein L19, putative similar to 60S ribosomal protein L19-3 (Swiss-Prot:P49693) [Arabidopsis thaliana] Length = 101 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 309 KKIDRHLY-HSLYMKAKGNVFKNKRVLMEYIHRKKAEK 419 KKID+ +Y H ++MK KG V+KNK VLME +H+ E+ Sbjct: 29 KKIDKLVYYHDMFMKVKGKVYKNKCVLMESMHKSSRER 66 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 28.7 bits (61), Expect = 3.1 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = -2 Query: 445 WSLSIFVLAFSAFFLWMYSMSTRL 374 W +S+ ++AFS FF+++Y+ S ++ Sbjct: 1377 WVVSLTLIAFSMFFVFIYAFSVKI 1400 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 112 DGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTAN 231 D + KK + + + ++RKN + RR+G G G RR A+ Sbjct: 77 DVIYWKKLLELENSGKIRKNPKPRRRGDKSGDGFRRTGAD 116 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/71 (25%), Positives = 33/71 (46%) Frame = +1 Query: 70 ANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTANARMPQK 249 A+ + RK ++ + + S R+N +R+ H G GKR + N+ ++ Sbjct: 303 ASNELNRTPRKQVQKKSALLRLETPRSYKNSRENEWSRQHNHHNGNGKRFNS-NSYRGKE 361 Query: 250 ELGYKDKGF*E 282 LG+ D+G E Sbjct: 362 HLGHSDRGLVE 372 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 134 GFLMTRPSLIILRMFCLELVFAISLISFGSNH 39 GFL P +++L M + +S+IS+ NH Sbjct: 2 GFLKLSPMILLLAMIGVSYAMDMSIISYDENH 33 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 148 SRARVRKNTEARRKGRHCGFGKRRGTANARMPQKEL 255 SR+R R + +R +GR + R + ++ P+K+L Sbjct: 209 SRSRSRSRSRSRSRGRGRSHSRSRSLSRSKSPRKDL 244 >At3g06210.1 68416.m00714 expressed protein contains Prosite PS00616: Histidine acid phosphatases phosphohistidine signature; Length = 840 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 259 TQVPSVAYAHWLYLFSYQS 203 ++VP + YA WLY+ SY S Sbjct: 207 SEVPLLPYARWLYISSYVS 225 >At3g04340.1 68416.m00459 FtsH protease family protein similar to chloroplast FtsH protease [Arabidopsis thaliana] GI:1483215; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 960 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 306 AKKIDRHLYHSLYMKAKGNVFKNKRVL 386 A K+++ +Y Y KAKG + KN+RVL Sbjct: 870 AGKVEK-IYDLAYEKAKGMLLKNRRVL 895 >At2g32000.1 68415.m03910 DNA topoisomerase family protein similar to DNA topoisomerase III beta-1 (EC 5.99.1.2)(SP:Q9Z321) {Mus musculus} Length = 865 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 112 DGLVIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGT 225 D L++ H R+ VR+ R +GR G G RRG+ Sbjct: 816 DELLLSLVEVKHGRSFVRRGGRGRGRGRGRGRGGRRGS 853 >At1g16370.1 68414.m01958 transporter-related low similarity to organic cation transporter OCTN1 from [Homo sapiens] GI:2605501, [Mus musculus] GI:4126605, [Rattus norvegicus] GI:5679326; contains Pfam profile PF00083: major facilitator superfamily protein Length = 521 Score = 27.5 bits (58), Expect = 7.2 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 6/82 (7%) Frame = -2 Query: 430 FVLAFSAFFLWMYSM---STRLFLNTLPFAFM*SEWYRCLSIF-LAVLYF--RSNFLKTL 269 F++ FS W Y++ S R+ P A M L L+ + F + + + L Sbjct: 183 FIIGFSRSQTWSYALVLISERVSTRWRPRATMIPFTLFVLGFMSLSGIAFLAQDSSWRYL 242 Query: 268 CLCTQVPSVAYAHWLYLFSYQS 203 L T VP+V Y +LYLF+ +S Sbjct: 243 YLYTSVPAVFYCIFLYLFALES 264 >At1g11880.1 68414.m01370 expressed protein contains Pfam profile PF04188: Protein of unknown function (DUF409) Length = 489 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -2 Query: 331 YRCLSIFLAVLYFRSNFLKTLCLCTQVPSVAYAHWLYLFSYQSHSDD 191 Y+ +LA+ F + FL+ +C+C +P VA+ + Y H+ D Sbjct: 239 YQKRRAYLAMQVFIAGFLRCICIC--LPFVAFQAYGYYNICHGHTRD 283 >At5g59500.1 68418.m07457 expressed protein Length = 396 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 481 VPPSLYCGGPQHWSLSIFVLAFSAFFLWMYSMSTRLF 371 VPP+ + G + W +F LA+ FF + S+ RL+ Sbjct: 196 VPPAYFNGYLEGWPY-VFFLAYHYFFFFNVSVRKRLY 231 >At1g23830.1 68414.m03006 expressed protein Length = 345 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -2 Query: 490 GACVPPSLYCGGPQHWSLSIFVLAFSAFFLWMYSMST 380 G C+ SLY WS S+F+ F FFL S ST Sbjct: 145 GGCLITSLYV---LLWSTSVFLFFFLFFFLQFLSGST 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,920,865 Number of Sequences: 28952 Number of extensions: 259968 Number of successful extensions: 727 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -