BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30934 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 3.8 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 5.1 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 5.1 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 22 5.1 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 327 IFVSFFIYV*TLSEWAGPHNITKI 256 + +SF + TL E+AG H TK+ Sbjct: 311 LLMSFGYCIATLLEFAGVHYFTKV 334 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/24 (29%), Positives = 19/24 (79%) Frame = +3 Query: 285 IHLVFKHK*RMKQILE*FQKRELI 356 +HL+F+H + +++L+ F++ +L+ Sbjct: 147 LHLLFRHFSQRQEVLQAFKQVQLL 170 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 712 CR-RFHF*VMPINKLILDKRFPANYLSDRSVIL 617 CR + H + NKLI RFP N + S+ + Sbjct: 148 CRPKIHVFSLHDNKLITMYRFPQNQFKESSLFV 180 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/24 (29%), Positives = 19/24 (79%) Frame = +3 Query: 285 IHLVFKHK*RMKQILE*FQKRELI 356 +HL+F+H + +++L+ F++ +L+ Sbjct: 115 LHLLFRHFSQRQEVLQAFKQVQLL 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,307 Number of Sequences: 438 Number of extensions: 3323 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -