BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30932 (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.05 |||translation initiation factor |Schizosaccharomyce... 44 2e-05 SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizos... 26 6.9 SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 25 9.2 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 25 9.2 >SPBC16C6.05 |||translation initiation factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 190 Score = 44.4 bits (100), Expect = 2e-05 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 152 VQYCGNCSMPIEYCEYYPEYDKCKQWLEKNLP 247 V YC C++P+EYCE+ KCK+WL+ + P Sbjct: 12 VLYCDVCTLPVEYCEFEGTLKKCKEWLKSSHP 43 Score = 44.4 bits (100), Expect = 2e-05 Identities = 22/46 (47%), Positives = 27/46 (58%) Frame = +1 Query: 373 VQVSRAPRGKKKSVTVVSGLSTFDIDLKVAAKFFGTKFACGSSVTE 510 V + R K+K VT V GL F I+ K AAK KFA G+SVT+ Sbjct: 99 VLIKTIERTKRKRVTTVQGLDAFGIETKKAAKMLANKFATGASVTK 144 Score = 44.0 bits (99), Expect = 2e-05 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = +3 Query: 507 RDDEIVIQGDVKDDLFDIIPEKWPEIDEDSIEDLGDPK 620 + DEIV+QGD+ D+FD I EK+ E+ ED+I+ + D K Sbjct: 148 KKDEIVVQGDLNYDIFDFILEKFKEVPEDNIKIVEDTK 185 >SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 452 RSISKVLNPDTTVTDFFLPRGARDTCTNLGTSSFFLDFN 336 RS +V+NP+ +VTD P G + G SSF N Sbjct: 223 RSRKRVVNPECSVTD--TPYGKLNNVIGEGASSFIRVIN 259 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 590 FINFWPLFRYDIKKIIFNITLN 525 F+NF PLFR K+I+N+ LN Sbjct: 965 FVNFVPLFR----KVIWNLLLN 982 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 607 LVIQKGSVPYTKRRFTPG*YFISLYNVKNCHFQN 708 L IQKGS P ++ +F S ++V N H Q+ Sbjct: 52 LKIQKGSFPAIRQPTESSTHFQSSHSVSNAHNQS 85 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,783,846 Number of Sequences: 5004 Number of extensions: 54261 Number of successful extensions: 164 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -