BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30932 (776 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 26 1.1 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 25 3.5 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 3.5 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 3.5 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 8.0 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/16 (68%), Positives = 12/16 (75%), Gaps = 2/16 (12%) Frame = +2 Query: 728 IFWIYPHFRP--VFWL 769 IFWIY HFR +FWL Sbjct: 13 IFWIYFHFRQRYLFWL 28 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 433 SIQTRL*LISSCPEEHEIPALIWEHLLSSWILTYPCHHASGVFFL 299 S + RL + + E+ LIW+ + I+ +P HAS + L Sbjct: 333 SNRARLRQLQASLSSAELDRLIWQMKMHKAIVQFPRMHASNTYDL 377 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 550 FLISYLKSGQKLMKTVL-KILVIQKGSVPYTKRR 648 FL+ Y S Q++MK +L + L K S P KR+ Sbjct: 281 FLVVYANSQQQMMKPMLQRHLTRNKRSQPARKRK 314 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 24.6 bits (51), Expect = 3.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 119 GPREGVTYPIKVQYCGNCSMPIEY 190 G GV+Y + Q C NC+ P+ + Sbjct: 15 GEVTGVSYRGQAQTCRNCAAPVHH 38 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 543 DDLFDIIPEKWPEIDEDSIEDL 608 D LFD + E W +I ++I++L Sbjct: 208 DHLFDHMQEVWSKIPPETIQNL 229 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,990 Number of Sequences: 2352 Number of extensions: 12817 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -