BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30921 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0842 + 21754800-21754932,21755513-21756267 30 1.6 12_01_0774 + 7063465-7064011,7065183-7065791,7067905-7068464,706... 29 2.8 08_01_0271 - 2189482-2190567 28 8.5 >08_02_0842 + 21754800-21754932,21755513-21756267 Length = 295 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 654 WRRGSENRA-CIWRRPMAGVGIGNAGVHLCHGLAYPIAGN 538 WRRG A C W+ A +G G G C G+A+ G+ Sbjct: 184 WRRGRAGAAWCGWQEDGATMGDGGDGPARCGGVAWETCGD 223 >12_01_0774 + 7063465-7064011,7065183-7065791,7067905-7068464, 7069411-7069530 Length = 611 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -2 Query: 619 AATDGGRRHRKRGRTFMSRASVPDSWKR*EFCSRGLWSNPIIPHGPVGCNDSAGCFPIH 443 A+ D K+GRTF+ A + W+R R + NP++ H + D G P+H Sbjct: 472 ASPDSADIRDKQGRTFLHIACADEGWQRPTV--RYVVKNPML-HDLLNSQDKEGNTPLH 527 >08_01_0271 - 2189482-2190567 Length = 361 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 671 RSVNNSGDVEARIEHASGGDRWRASA 594 R V SGDV + HA+GGD A A Sbjct: 124 RQVMESGDVGVLLRHAAGGDEVAARA 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,012,935 Number of Sequences: 37544 Number of extensions: 365750 Number of successful extensions: 1108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1108 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -