BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30919 (736 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0785 - 31730300-31730701,31730785-31730856,31730940-317328... 30 1.7 12_01_0182 + 1345209-1347065 29 5.1 >02_05_0785 - 31730300-31730701,31730785-31730856,31730940-31732864, 31733000-31733150,31733944-31734009,31734247-31734645 Length = 1004 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -3 Query: 176 IWAVKPHANITNRSL--KLISEICSRDLRYVQVMLC 75 IW + PH NI NR + +IS C VQ ++C Sbjct: 496 IWDIDPHGNIINRWIGRTVISSCCKLSYDLVQDLIC 531 >12_01_0182 + 1345209-1347065 Length = 618 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 374 SRALDPTSCLPSSTLEASTISRMLPSAYS 460 S L PT+ L +S L AS+ SR LPSA S Sbjct: 90 SSPLPPTTFLANSLLLASSSSRCLPSALS 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,620,077 Number of Sequences: 37544 Number of extensions: 370959 Number of successful extensions: 697 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -