BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30919 (736 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 24 5.6 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 24 5.6 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 23.8 bits (49), Expect = 5.6 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -1 Query: 370 RSTPSVSLLNASGKLSKQNFFQFLAEVCLPGSQSQFCNT*VCTVVLHRMLFTA*NC 203 R+ V+LL+ K S + F V L C T ++ R LF+A NC Sbjct: 53 RNCGGVNLLDLMYKESHRWAMPFQTYVTLTMLDMHTCQTDKSVKLMERSLFSARNC 108 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 23.8 bits (49), Expect = 5.6 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -1 Query: 370 RSTPSVSLLNASGKLSKQNFFQFLAEVCLPGSQSQFCNT*VCTVVLHRMLFTA*NC 203 R+ V+LL+ K S + F V L C T ++ R LF+A NC Sbjct: 53 RNCGGVNLLDLMYKESHRWAMPFQTYVTLTMLDMHTCQTDKSVKLMERSLFSARNC 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,083 Number of Sequences: 2352 Number of extensions: 15605 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -