BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30916 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 39 4e-05 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 39 4e-05 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 36 4e-04 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.1 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 7.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.3 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 38.7 bits (86), Expect = 4e-05 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 584 INEPTAAAIAYGSLTKRGTGERNVLYLWTSGG 679 INEPTAAAIAYG L K+ ERNVL GG Sbjct: 1 INEPTAAAIAYG-LDKKAEKERNVLIFDLGGG 31 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 38.7 bits (86), Expect = 4e-05 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 584 INEPTAAAIAYGSLTKRGTGERNVLYLWTSGG 679 INEPTAAAIAYG L K+ ERNVL GG Sbjct: 1 INEPTAAAIAYG-LDKKAERERNVLIFDLGGG 31 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 35.5 bits (78), Expect = 4e-04 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = +2 Query: 584 INEPTAAAIAYGSLTKRGTGERNVLYLWTSGG 679 INEPTAAAIAYG L K+G E+N+L GG Sbjct: 1 INEPTAAAIAYG-LDKKG-AEQNILVYDLGGG 30 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 124 LPAREGGDHRQRPGQQDH 177 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 625 NKKGYWRTKCTLSLDL 672 N+K YW C L+L + Sbjct: 52 NRKYYWLNVCCLNLSI 67 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 123 TPTQEYVVPRSIPT 82 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,875 Number of Sequences: 336 Number of extensions: 3932 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -