BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30916 (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 66 1e-12 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 0.96 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 25 2.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.9 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 65.7 bits (153), Expect = 1e-12 Identities = 37/57 (64%), Positives = 38/57 (66%) Frame = +2 Query: 509 YFNDSQRQATKDAGTIFWLETFSEFINEPTAAAIAYGSLTKRGTGERNVLYLWTSGG 679 YFNDSQRQATKDAG I L INEPTAAA+AYG L K GERNVL GG Sbjct: 9 YFNDSQRQATKDAGAIAGLNVM-RIINEPTAAALAYG-LDKNLKGERNVLIFDLGGG 63 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 26.2 bits (55), Expect = 0.96 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 263 IVLWGSSPPGSWRHLR*DARCL*TQHK-TEWSCC 165 IV+WG PPG + R D R ++ K ++ +CC Sbjct: 329 IVVWGKRPPGEAENSR-DQRMAKSKRKFSQQNCC 361 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 25.0 bits (52), Expect = 2.2 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = -2 Query: 650 FVLQYPFLLKNRKQSQQQSVH**IRRTFQARRWYLHLLWLVFESH*SSGNRDNCILHSFA 471 F++++ L+ R ++ I+ TF R+Y+HL L F + G+ N L+ Sbjct: 150 FLMKWNGALEKRANGKEYYQMNKIKATFDTTRFYMHLTNL-FNGDKALGDNMNQFLNDNW 208 Query: 470 QDKLRQ 453 +D L++ Sbjct: 209 EDILKE 214 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 64 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 165 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,814 Number of Sequences: 2352 Number of extensions: 17973 Number of successful extensions: 63 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -