BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30913 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|c... 27 3.4 SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch... 26 4.5 SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces po... 25 7.8 >SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 26.6 bits (56), Expect = 3.4 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = +1 Query: 58 YCDVDFSERPRNFSIELLYHTQTQTDGHVVISPFGIWTLMTGIALGASGNSYRQLSRAFI 237 Y + F+E N + TQT D +PFG++ L+ G+ S R + AF Sbjct: 248 YHGMVFTETFGNLAYAFACRTQTLRDVGGNANPFGVFLLLQGLET-LSLRMERHVQNAFA 306 Query: 238 LPK 246 L K Sbjct: 307 LAK 309 >SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 979 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 516 GSSQSAERSRRVPRIFRCRCWLFE 445 GS+ E + +FRCRC +F+ Sbjct: 71 GSNDDEEDDLDITTLFRCRCMIFD 94 >SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 5 ISAGCIQSRSFFFSSARVIVMSISAR 82 IS+ C+Q +SFF +AR + S+ +R Sbjct: 158 ISSICMQVQSFFSPAAREAISSLKSR 183 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,885,294 Number of Sequences: 5004 Number of extensions: 61367 Number of successful extensions: 164 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -